CAZyme Information: KSA00790.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA00790.1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	LMYN01000074|CGC1	47209.34	4.8288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000074:13789-15030(-)

Full Sequence      

MTRDAYLEEIKDYLYGDATVAKIWGVATPALSEPQPPSEFPDYSKGNRYTCRDSDFWTSG
FFPGSLYTLLARNEKYPEYFPSQKINPVKLEYAAKWWAEGMVKHKNKTDNHDLGFMLVPS
FETEYLRSESEKSKEVLIKGANSLASRFDEKVGCIRSWDELFPIKGEGSRTSNFDKDLVV
IIDNMCNLNLLYLGAELSGDSRLADIATTHAETTLKNHFRDDWSSYHVVMYDRETGKAKD
KFTFQGYADESAWTRGQAWGILGYVETYMYTKDKKFLDAALNITKYYLSMLPEDGVPPWD
FDAPDKHIRDVSSGMAAAFGMLKIYECTKDEEILNYALKLVNDCIKLAYNKKATLNNDGT
VDLGQTDTILGKSTFINNPDVVEEWKIFDHGLVYADYYFLMIGNKLLELGLYK

Enzyme Prediction     

No EC number prediction in KSA00790.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	50	401	2.9e-106	0.9787234042553191

CDD Domains     

KSA00790.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86548.1|GH88	2.50e-295	1	413	1	413
CAR65600.1|GH88	1.90e-222	1	413	1	408
CAG86543.1|GH88	3.17e-206	6	413	10	414
CAG86594.1|GH88	5.05e-204	1	412	1	407
CAG87553.1|GH88	3.50e-164	7	411	10	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	6.42e-51	57	409	73	391	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	7.15e-45	47	400	58	383	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	7.31e-45	47	400	59	384	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	3.85e-44	47	400	59	384	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	3.85e-44	47	400	59	384	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	1.22e-55	57	400	77	388	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8E372|UCDH_STRA3	3.76e-44	47	400	59	384	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	7.16e-43	47	400	57	382	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.48e-42	44	400	57	385	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.37e-36	40	324	24	292	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999850	0.000167

TMHMM  Annotations     

There is no transmembrane helices in KSA00790.1.