CAZyme Information: KRZ99919.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KRZ99919.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		45738.49	4.5458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000113:21219-22541(+)

Full Sequence      

MKLSQSVLISLIGSIATASAADSDVRVEKRMVQYVTKVTTVQIPLADYLAGKKTAQQAAT
TQAATTAAAVAASTQSKSKGGLLGFLEGLFDNDDSQSSTSTTSSANNGGGLFGSPTTTSA
VGTNVVGTSTLSTASSSSDSPLFPIFTASSSSDITSPSSSSDSGSDSEGSFANNIAAAKG
AKGITYSPYTKSGSCKTASEVKSDIAKLSSFSLIRLYSTDCNGIENILASMTSSQELFLG
IYEIDTNTITSGLETIKSAVEATTRGWSAVHTISIGNERVNDGKSSVSDLATAIKTARSW
LSTNASDYTGYVVTVDTLVATVSNPGLCKISDYLAVNAHPYWDGGVVPSNSGSWLQQQIS
NLESACGSSNILITETGWPTQGNTYGSCVPSISNQLAAIKSIMSKFSDQVFMFTMYNDYW
KDPGSENVEQHWGIFGDPSA

Enzyme Prediction     

No EC number prediction in KRZ99919.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	184	435	3e-24	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.22e-72	176	435	40	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.94e-10	279	435	126	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85772.1|GH17	3.79e-237	1	440	1	431
CCG22480.1|GH17	6.84e-131	167	439	266	539
CCE40615.1|GH17	5.44e-130	167	439	277	550
CCE82163.1|GH17	1.43e-128	155	440	190	478
CCE83086.1|GH17	6.93e-128	174	440	239	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.26e-10	183	436	39	283	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	7.29e-10	183	436	39	283	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53334|SCW4_YEAST	1.09e-77	178	434	130	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	1.19e-77	178	434	133	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	4.80e-77	180	435	125	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53189|SCW11_YEAST	2.63e-46	182	434	282	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.32e-44	177	435	304	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999691	CS pos: 20-21. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in KRZ99919.1.