CAZyme Information: KRZ98647.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KRZ98647.1
• CAZy Family: AA6
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A0V1PQY1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774	LMYN01000234|CGC1	86939.87	6.5726

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000234:278-2602(+)

Full Sequence      

MGFSDLKNAIKKIDQSLKEKNRAKGGGRSADKAQQSYPNQEKAYQPSHDNAQVPLAADND
IFAKPIATSEPPSIFKRTQHAQPPQGCSCGESDDPVQTNNFSNNLTLGDQTFPVWTLPYS
LWYTMDPDQDVGFAFNHTDASQRVFGPDPDSNPAQFYFNPPKIKSFVLSGANFRDNNVSV
KLENHNKLSVTSKLVLDNDANKNVTVPLVHGMGFITAIYNNIQPVIASQVGVQDFKHVGL
VGNVTKYKVTLFNQVVWSLYVSGDTSIKLNLQDPNHIVADKVSSNSIIQICRGESKFYDD
SCGIYADSCHLQGSCTSGDGKICQYKFIYGMKGSSKSGNGIVWCLPHHQEVLTNEIKKRD
TKLELDSTTKGLMKAYATNELIMEETDLPVAVNWEPWSSLSSFKGKPSYSEGAKNIIRTA
AEDEVQQDVVGMANIDSMYTSGKILDKFAYIAYVCHFILQDDKLTSTILPKVQEAIEIFA
RNHQKFPLVYDLSWKGLISSAEPGADFGNSNYNDHHFHYGYHIHAIALVAKVDESFGKNE
WLHKNDNLVLNYALTLLRDVANPSKDDKYFPQSRSFDWYHGHSFAHGIFASGDGKDEESS
SEDYHFAYGMKLFAKIIKDSNMEVRANLMLAIMKRSMNMYMLYSDDNKIQPKRFIKNKVA
GISFENKIDFATYFGRGQIADEWIHGIHMLPITPVSSYIRNGDFVQEEWDQKLAGIIDQI
TDGWKGILMLNFSLTNPKQSWKWFSRKDWDNTLIDNGMSRTWSLAYIAGIGGSD

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	78	766	1.2e-220	0.9967845659163987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	57	774	50	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	408	764	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.39e-134	80	399	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG90011.2|GH81	0.0	1	774	1	773
CCE83132.1|GH81	0.0	1	774	1	769
CCE84163.1|GH81	0.0	1	774	1	769
ABN66990.2|GH81	0.0	1	774	1	755
CCG24550.1|GH81	0.0	1	770	54	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.61e-79	57	764	3	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.11e-79	57	764	28	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.58e-76	57	764	3	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	1.30e-17	490	757	418	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	1.35e-17	490	757	438	691	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12168|ENG2_YEAST	3.22e-189	46	766	59	774	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	6.99e-170	60	769	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	5.64e-164	66	773	406	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	4.33e-160	65	773	6	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.95e-157	46	769	178	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KRZ98647.1.