CAZyme Information: KRZ98461.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KRZ98461.1
• CAZy Family: AA3
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0V1PQE8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	LMYN01000278|CGC1	93339.26	5.6578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000278:637-3150(-)

Full Sequence      

MYQSLDIENIIEKMTVLEKAQLLAGVDRWHTAAIPRLNIPSIRFTDGPNGVRGTSFFPGI
KSACFPCGTSLGATWDKRMLYEVGELLAIEAKHKSAHVILGPTVNIQRSPLGGRGYESYS
EDPVLSGLLAAAIINGIQGKGIAACIKHYVCNDIEDERIAININISERAIREIYIKPFML
ALKYANPAVLMTSYSKVNGTHVSQSKKLLKELLRDEYGWGGTIISDWYGTYDTKLSIKNG
LDIEMPGPPKLRIPFQVSLQIKSKELHVDDLNDRVKNILKLIDYLKDSYIPEGGTEDENN
NTTGTANKLRAYSSNGIVLLKNENDVLPLRTSEKIAIIGPNAKNTSAHGGGSAALNAYYT
LSPYDCINKRFVYEVDYTVGAYSHKLLPQLGPQMIREDNLQGYSCKVYLDPPSVENRTLI
DHFNLSNSYIRLPDYENKQIPQSNIFFMDMEGNFIPDDDDYYEFGLTVVGTAQLFIDGKL
IVDNKSNQRRGTSFYNTGTLEEKGTVFLRKGQKYKIKIEFGSGPTSTLLGSTDSLSDAGG
AIAFGGCKVIDPEKEIQKAVEIAKQNDKLIVVIGLSGEWESEGYDRPDMRLPGLTYKLVE
EVSKVNKNVIVVNQSGTPVDLLFLDNIPALVQHWFGGNEGANALADILFGDVNPSGKLPL
TFPKRVQNNPSFLNFKSERGQVTYGEGIFVGYRYYEAVDQEVIFPFGFGLSYTKFDFANL
NIEKITDNKIKLSVTLENIGDRDGKEVVQVYVSQQSTTVNRPRKELINFEKVFIKKGQIE
TVYNDLDLKLATSFWDEYANKWISEAGDYNILVGNSSDNITLCKSFKIMKETFFLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	246	1.3e-59	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.65e-70	65	817	120	754	beta-glucosidase BglX.
224389	BglX	5.10e-63	29	353	50	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.16e-58	317	692	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.64e-50	10	815	56	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.43e-33	36	281	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN67130.1|GH3	0.0	6	836	7	838
CAG85284.2|GH3	0.0	6	837	72	904
CDR44766.1|GH3	3.41e-317	6	837	5	839
CDR47499.1|GH3	1.85e-311	1	837	1	839
CCE84110.1|GH3	6.27e-311	6	836	5	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.68e-281	6	837	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.76e-277	6	837	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.29e-131	4	828	2	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.72e-117	11	820	9	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.65e-95	7	834	4	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6J6|BGLS_SCHPO	2.14e-288	6	837	5	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.97e-285	6	837	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.96e-281	5	837	4	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	4.96e-281	5	837	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.78e-278	5	837	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000092

TMHMM  Annotations     

There is no transmembrane helices in KRZ98461.1.