CAZyme Information: KNZ62306.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ62306.1
• CAZy Family: GT2|GT2
• CAZyme Description: 1,3-beta-glucanosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A0L6VNG1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		65786.96	8.1933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01003209:21336-24084(+)

Full Sequence      

MCKVVLPSSPYGSDIIGPYMHTGGHYCYGRKAMVVMFNEFRGSFISKVEAQADDEHSMLF
NKMNALRVGLAFSSVGTPRITRVGRYLYDANGKRFYIKGVAFQKDGNLLDLDRQAVNLYI
YSLGEKRYVVTLNFLMLGLKINTVRVYSYDTEKDHSICMNALEEAGIYVIADITLPRING
ASQTWDVDLLREAISQIDALRGFPNLLAFNIGNAIINNMENLEAGPYIKARARDVKLYLK
SVNSTALVAYTSADGEKFPADLARFLSCNFEGPSVELDLFGLNNHRWCGDSNFASSYEEL
TMDFQGLTIAAFFSEFGFCSPGKPREWSEVPILFSALMSDLWSGGVAYSYYPTPKGYGLL
DIKAEKKPSRNQDFKNLAQRYHHVKAPNIPKLTSLVLPKQQCSSTNSNSFVITSVLPPQP
NADACDCMDQRALSCHIRGDASPLVIAELLEEVCKDLGLNAGFGEGCAAISSSGKANYGA
LSACSPATKLNYAMTHRFINSGFDPKACNFSGNATIQSQIQTKSAGEVARETTKCFKINA
GKGISNKPTGRASKNTPVQINTIAYQQSISGVRVQSTAKFSEGPSIPSKSTTLPLLQETF

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	77	383	8.5e-78	0.9807692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	8.86e-78	67	381	1	311	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	6.44e-09	433	515	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	5.65e-07	433	519	1	76	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	0.004	91	271	11	177	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW47197.1|CBM43|GH72	6.05e-104	78	544	21	496
ADV25841.1|CBM43|GH72	1.16e-103	78	518	21	471
AUB28916.1|CBM43|GH72	2.44e-103	68	518	12	472
AFR98731.2|CBM43|GH72	2.44e-103	68	518	12	472
UOH85570.1|CBM43|GH72	9.31e-103	68	518	11	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W61_A	2.38e-61	69	508	27	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
2W62_A	2.38e-61	69	508	27	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
5FIH_A	2.38e-61	69	508	27	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P378|GAS1_SCHPO	3.36e-75	68	518	14	449	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1
sp|P56092|EPD1_CANMA	8.12e-74	78	556	26	482	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|P22146|GAS1_YEAST	1.54e-71	58	531	1	468	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|O13318|PHR2_CANAL	2.20e-70	78	518	26	454	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|P43076|PHR1_CANAL	4.70e-70	70	555	19	488	pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR1 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KNZ62306.1.