CAZyme Information: KNZ62262.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ62262.1
• CAZy Family: GT25
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663		75346.30	8.8727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01003265:17745-20758(+)

Full Sequence      

MRIFPIFLGVIWTERTRCDDATAPSASSTVTRTSSESHDRSHSGFVRAPGDGNLYLDGNL
FNFRSFKWRTNNLWRCAAKNSKDVTYSKALKNLVLPSPERIPYRLLTRAWSMERCRPLLG
TSSVGTRTRTVFCSSSKSSISSITRGDRSCSDPPASLILPHPPPQLSEDWIYNEDQWKKM
DLMLCLSRHYGVKLIIPIINQVSGSVTRAYGNPEINHVGDFNDLIRHRYGIWGYLDAGKR
VDFFKDRTMINSFKSLITFFLNRVNTCNGIRYGDDNTILAFETGNEMSWGRYANLSGSSI
LFLTYFSQTQKQWTIEISHHLKTLAPNILVMDGSLYLIGPLIFQLPSPLFRLGGGGIEEQ
RGGSLRISLLVDGDGDTELFDMLNAKVRKYGKTLVIGEHGFCELITLGEKNSNVHVWRDV
YKKMTCAGALAWSLLPHSEKGGFLTRSEGHNIYAYHVPGWKRQTSPNFDTQEDEPPPKPI
PGRPEAFIVSNGSHVGLSWRGEAWAAGYEIFGAEPRDRDFHLISDVIPDNVEAGKLFIPL
DPERPTEPLRIPTRKSKSEEPHKGWRDRKWCWRNSFLHGCHDDDDDDRYQGHHHHEKNLL
DILGNFIGQSLMTVLSPMEPPRHRHRHHPGGWYSVRGVSADGIRGKPSRPVFLDADWRRE
NSR

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	167	335	3.4e-24	0.5

CDD Domains     

KNZ62262.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	1.69e-60	168	490	15	343
ALL40758.1|GH5	3.83e-49	373	651	36	319
CDR43041.1|GH5	7.14e-46	169	543	129	482
ABR27262.1|GH5_41	7.48e-25	172	529	105	410
UHA60211.1|CBM16|GH5_41	2.05e-24	173	535	582	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	5.33e-09	174	334	96	224	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	8.69e-09	174	334	82	210	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4QP0_A	4.48e-07	242	334	131	219	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5W6G0|MAN5_ORYSJ	6.92e-09	171	340	150	291	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q0JKM9|MAN1_ORYSJ	1.31e-07	172	333	111	245	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
sp|Q9LZV3|MAN6_ARATH	5.48e-07	171	340	119	261	Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana OX=3702 GN=MAN6 PE=2 SV=1
sp|Q10B67|MAN4_ORYSJ	2.99e-06	164	333	89	231	Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN4 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.855266	0.144744

TMHMM  Annotations     

There is no transmembrane helices in KNZ62262.1.