CAZyme Information: KNZ61972.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ61972.1
• CAZy Family: GT22
• CAZyme Description: N-acetyltransferase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0L6VN22]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
999		113816.86	8.6400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01003665:10391-14451(+)

Full Sequence      

MRIGISAGLECVSWACPPVHAQRPPDTQDPFFDRTGERKQFVSQNQNQKNDGDNNDNDTE
PQDSDGNSNGKGCNSGPVSELFLLLLLESEKGRRIMSGRFGSSTRCSFPSAIAISFTAKS
WTTISRIIVNSVIYYNDLPVGAVCCRIEPDPSDHPTPALTGKANESQTNGSLQPSKLCKL
NIMTLGVLAAYRQQGLATKLLNQVILAAQKTHDRSGTSLQMNGESSISESKKGKKSRSEE
RRVMMPSIGSAYVHVQFGNEDAKEFYLKRGFRVEGEVADYYRKIEPRGAWILLIERMKRP
LKSKSLSLPHQRLPFTSLGTPGINEVQGSFFAEYKEPEEEEQEEEEEEEEDGELLLPTTT
NSRTKKTNKKPLSIHPISLLPAFILGVIITLYSSLQNSTTQTTLNSPFINHKPPLIINRD
HVYLPYHYLNHTWTLNPSKHQYPILQLIHNASQAWSSKLARQSKSIPEAVIEYKKRYNRP
PPTGFKEWFIWAQENDVKLIDEYDRINELIEPFWALPPHVLRNRTEQEGKNDAFSTFIVK
NGTVKAIGPKKDAPRTIDQLKLLEVIVPHLPDVNVTMSHHDGPSVFMDWTTKQRHLDHAR
AGKILPPELIDKLMGIRWRVCSRFSDAHVGERVGPRSQRPECRARRIYRLGSRKNYGFVR
ASRVARFPWSLFFSPFLLLCKIGLRVDSDWGEGVTGFTAWAGPRPLPLRPIFSFAHSPGF
VSDILNAPLEQFEDSSKNEEQTTGVWFDRQTNWRKSHRVRLHRLGVAPAHQYGHDLKRRL
RTPGLRAPHSLNLSDLSSLNNQDLPVVVVEKEYSLAQLSQRYLSASFVGNLVQCTVEDSS
CEAISKEIEFGEPVDWQFQNNFKYVLDVDGNSWSGRFRRLLKSNSVVFKSTIWPEWYRDQ
IQAWHHYVPVRIDYAELFDLMSFFTGSPEAPSAATGEKDGEDRVVTPGFDHLAKLIALQG
SDWADQHFRYQDIRAYVWRTYLEWARVSADNRLQMNFVL

Enzyme Prediction     

No EC number prediction in KNZ61972.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	747	987	1.7e-44	0.664

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.50e-11	852	976	136	241	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.95e-07	859	986	213	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
173926	NAT_SF	0.004	132	210	3	56	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	2.77e-116	374	997	154	752
CDR48932.1|GT90	3.33e-82	442	998	171	695
CDR40950.1|GT90	4.14e-82	437	991	166	693
CDR40393.1|GT90	1.87e-81	442	987	114	631
CED83568.1|GT90	1.18e-78	441	999	175	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TFY_A	1.06e-12	134	292	50	150	Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and CoA [Homo sapiens],3TFY_B Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and CoA [Homo sapiens],3TFY_C Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and CoA [Homo sapiens],4X5K_A Human NAA50 complex with coenzyme A and an acetylated peptide [Homo sapiens],6PPL_A Cryo-EM structure of human NatE complex (NatA/Naa50) [Homo sapiens],6PW9_A Cryo-EM structure of human NatE/HYPK complex [Homo sapiens]
6WF3_A	1.11e-12	134	292	52	152	Crystal structure of human Naa50 in complex with a cofactor derived inhibitor (compound 1) [Homo sapiens],6WF3_B Crystal structure of human Naa50 in complex with a cofactor derived inhibitor (compound 1) [Homo sapiens],6WF3_C Crystal structure of human Naa50 in complex with a cofactor derived inhibitor (compound 1) [Homo sapiens],6WF3_D Crystal structure of human Naa50 in complex with a cofactor derived inhibitor (compound 1) [Homo sapiens],6WF3_E Crystal structure of human Naa50 in complex with a cofactor derived inhibitor (compound 1) [Homo sapiens],6WF3_F Crystal structure of human Naa50 in complex with a cofactor derived inhibitor (compound 1) [Homo sapiens],6WF5_A Crystal structure of human Naa50 in complex with a truncated cofactor derived inhibitor (compound 2) [Homo sapiens],6WF5_B Crystal structure of human Naa50 in complex with a truncated cofactor derived inhibitor (compound 2) [Homo sapiens],6WFG_A Crystal structure of human Naa50 in complex with an inhibitor (compound 3) identified using DNA encoded library technology [Homo sapiens],6WFG_C Crystal structure of human Naa50 in complex with an inhibitor (compound 3) identified using DNA encoded library technology [Homo sapiens],6WFG_E Crystal structure of human Naa50 in complex with an inhibitor (compound 3) identified using DNA encoded library technology [Homo sapiens],6WFK_A Crystal structure of human Naa50 in complex with CoA and an inhibitor (compound 4a) identified using DNA encoded library technology [Homo sapiens],6WFK_B Crystal structure of human Naa50 in complex with CoA and an inhibitor (compound 4a) identified using DNA encoded library technology [Homo sapiens],6WFK_C Crystal structure of human Naa50 in complex with CoA and an inhibitor (compound 4a) identified using DNA encoded library technology [Homo sapiens],6WFN_A Crystal structure of human Naa50 in complex with AcCoA and an inhibitor (compound 4a) identified using DNA encoded library technology [Homo sapiens],6WFO_A Crystal structure of human Naa50 in complex with AcCoA and an inhibitor (compound 4b) identified using DNA encoded library technology [Homo sapiens],6WFO_B Crystal structure of human Naa50 in complex with AcCoA and an inhibitor (compound 4b) identified using DNA encoded library technology [Homo sapiens],6WFO_C Crystal structure of human Naa50 in complex with AcCoA and an inhibitor (compound 4b) identified using DNA encoded library technology [Homo sapiens]
2OB0_A	1.72e-11	134	292	51	151	Human MAK3 homolog in complex with Acetyl-CoA [Homo sapiens],2OB0_B Human MAK3 homolog in complex with Acetyl-CoA [Homo sapiens],2OB0_C Human MAK3 homolog in complex with Acetyl-CoA [Homo sapiens],2PSW_A Human MAK3 homolog in complex with CoA [Homo sapiens],2PSW_B Human MAK3 homolog in complex with CoA [Homo sapiens],2PSW_C Human MAK3 homolog in complex with CoA [Homo sapiens]
6YZZ_A	3.18e-11	134	292	53	153	Chain A, N-alpha-acetyltransferase 50 [Arabidopsis thaliana],6Z00_A Chain A, Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis thaliana],6Z00_B Chain B, Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis thaliana]
5L0R_A	1.76e-06	815	991	196	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.20e-62	437	992	147	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6DBY2|NAA50_DANRE	5.35e-12	134	292	49	149	N-alpha-acetyltransferase 50 OS=Danio rerio OX=7955 GN=naa50 PE=1 SV=1
sp|Q0IIJ0|NAA50_BOVIN	5.47e-12	134	292	50	150	N-alpha-acetyltransferase 50 OS=Bos taurus OX=9913 GN=NAA50 PE=2 SV=1
sp|Q5RF28|NAA50_PONAB	5.47e-12	134	292	50	150	N-alpha-acetyltransferase 50 OS=Pongo abelii OX=9601 GN=NAA50 PE=2 SV=1
sp|Q5XGA9|NAA50_XENTR	5.47e-12	134	292	49	149	N-alpha-acetyltransferase 50 OS=Xenopus tropicalis OX=8364 GN=naa50 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996864	0.003170

TMHMM  Annotations     

There is no transmembrane helices in KNZ61972.1.