CAZyme Information: KNZ61955.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ61955.1
• CAZy Family: GT22
• CAZyme Description: Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A0A0L6VP72]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1016	LAVV01003666|CGC1	114353.18	6.0941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01003666:12948-17126(-)

Full Sequence      

MPSNIESHGANVFIAAETTAGGIPGWVTTLPCHLRTNATLFERAWRQYWDEMIDQIVPNQ
FGLPNGTVVAVQIENEYLTDAHSYGQPPGKDQYMQDLAEALIDRGIVVPLTVNDAGMESN
FVTGTGAGDIYGFDSYPQSFDCSRPIQWKPVVESYRNYQDSLHLDSPLFLPEYVFLLRLF
VFMKVGLSWLNSADTVGYGRFQAGAYDSWGATGYENCRKLTGPEFQSVFYLNNLAANTKM
INYYMVYGGTNWGQLAFPGTYTSCSLNLTWYGDSDDYGSAISEDRTLTEKYTELKRQSFF
LRSSDQFYQTEVVGDSKHDADYFRGKQNHSAFVTELRNPTSGAGFYIVRALNSTSTQPTK
FKLNILTSLGLKQLPEMTLSPRESRLLVTDYETSSESENPAEPPPIKLLYTTSNVLLSAR
IGGHEVLYLFSNNNKPLGSQDTADAETSSIKILNMESEFLTRSFPDTDEPPSLHIFRDTN
FQGYREINWRIRDHASILAVGTQKSLVLMTSKQMAGEAWNPILAGTDSSTPPSSVLIWGP
WLVRNASIGMTDSPQEKKKKVLRIWGDFEEGVKKKVIIYVGGLDVGGGVEWNGKKIRNLS
RARDSSFLSFIYHPNSFERLMKDKTEKNNQLTHVGTRIDFQALNWTYRDSLPEIHHHYSD
HNWTHATLKESSNPYKKLYGKYYLYACDYGFCNGATIWRGHFEHKCNTFRDQHEPRLGLH
QESLLGINMTIAGGDFFAASVWLNDVFLGSVPNATSKLHPKVRRFLCLPIFLLYSKTHTN
TFLFAPGSLNECGSNVITVVQDSMGMDQTENGFADTVKHPRGILGYGFEGLESIEGSLGE
ITWKVQGHLGGFYSLPDPERGIYNENGFYGIVSVLADSHTPTRSGWHLPDHEKAEEERGT
NSTRQSPISDGMRSAGVGFYSTRFELDFVGGYDVMLSFVFREPAHEQPRYRVEFWVNGWH
MGNYFALTLWALDQEGAAISGGLELVVDAILEGGLVHNPQHSHHHPYNPHRRLDLV

Enzyme Prediction     

EC	3.2.1.23:18	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	13	296	2.5e-35	0.7100977198697068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	8.46e-37	5	296	72	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	6.76e-22	328	429	16	111	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	4.23e-17	658	807	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
198097	BetaGal_dom2	4.36e-15	332	429	21	112	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	7.32e-09	883	964	4	76	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW00634.1|GH35	1.87e-148	13	995	133	991
QRV86584.1|GH35	8.38e-145	13	995	133	991
QRW15140.1|GH35	3.21e-144	13	995	133	991
QRW10069.1|GH35	3.25e-144	13	994	160	1072
QRW27580.1|GH35	1.29e-141	13	995	131	989

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OG2_A	1.18e-90	13	981	118	972	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFT_A	2.39e-89	13	985	138	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
5IFP_A	3.29e-89	13	985	138	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
4IUG_A	2.67e-88	13	1000	138	994	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
1TG7_A	1.46e-87	13	979	98	938	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ58|BGALE_NEOFI	1.26e-93	13	986	134	984	Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacE PE=3 SV=1
sp|B0XXE7|BGALE_ASPFC	5.40e-91	13	994	134	992	Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacE PE=3 SV=1
sp|Q4WG05|BGALE_ASPFU	5.40e-91	13	994	134	992	Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacE PE=3 SV=1
sp|A2QAN3|BGALA_ASPNC	1.54e-88	13	985	138	979	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|B8N6V7|BGALA_ASPFN	1.38e-87	13	1000	138	994	Probable beta-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000006

TMHMM  Annotations     

There is no transmembrane helices in KNZ61955.1.