CAZyme Information: KNZ60686.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ60686.1
• CAZy Family: GT90
• CAZyme Description: GH26 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0L6VIS5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		43275.92	8.7320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01005764:7513-10292(-)

Full Sequence      

MSGLGVQQPSAASRNRHLCNGPSLRSSFLPFMDKPVASLPDGQWRGGIDTGLSNTNLNVN
GIAVGFLPALSEPIQPNTPLDINKRIGAPMSVMGSYIQLYSKDPNITEIDWQLPQYRQLI
GWPVWEIAIMPVEGLEKVTPDMAINIAKKMQFLNAQGITVWLRFAHEMNGDWYVWGQKPA
LFLEKWALVTKAVRSMAPKTLMLWAPNSGFGDTPDALLGGYTKYWPGGELVDMIVALHVL
MDLGGFRIVFLPLWRSATLPDSHERANVLPTPTEAEDTIKEFVRLFGSKNHDRPVVLAET
AASYTRSLDGKPAPGTANERDIKLAWLNQLVSRSMAQAVPELKAVIWFEVMKNENAAGNT
PVKSEDFRIVTSPVKPLAQDAHKLLSRRASQ

Enzyme Prediction     

No EC number prediction in KNZ60686.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396639	Glyco_hydro_26	1.19e-05	146	234	139	225	Glycosyl hydrolase family 26.
226609	ManB2	2.25e-04	154	242	176	258	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41269.1|GH26	2.62e-135	51	385	50	366
ALL40962.1|GH26	9.79e-78	90	386	1	278
ALL40740.1|GH26	5.44e-64	138	370	2	217
AGT80112.1|GH26	1.34e-50	51	347	61	358
QSZ50835.1|GH26	4.25e-31	127	354	109	351

PDB Hits     

KNZ60686.1 has no PDB hit.

Swiss-Prot Hits     

KNZ60686.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994153	0.005861

TMHMM  Annotations     

There is no transmembrane helices in KNZ60686.1.