CAZyme Information: KNZ58967.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ58967.1
• CAZy Family: GH65
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0L6VEI8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		33336.66	9.3469

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01006643:4344-5469(-)

Full Sequence      

MTRVHFPLLILALYSGLSEVLCLPPRPIALKAAPKSTQKPVLARTVSQCTPMVENFQSSK
LPPSWIQLSTNPQAHTMNPGGGVNLFINPPAGSVSMSADGKTNDKLGDGSTLNSTYSFLY
GKVSFTVAASNVPGAVVALVLFGTTAADEIDVEILGGDPKHWQTNVFRPAPGETEPLYGV
FGGVHNYPGSSTTANTHTYTVDWSPSGITWLVDGRSVRTLTPEQTLHNGQRHYPSARSRI
QVSLETLPLGTLADLRLHLNDSARIVGCKQPRRHQRVGARSSTMVRSPLFSSHNGQTSTK
TGVGDDQVDQG

Enzyme Prediction     

EC	2.4.1.-:3	3.2.1.39:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	106	244	3.3e-29	0.764367816091954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395585	Glyco_hydro_16	6.73e-35	92	244	11	149	Glycosyl hydrolases family 16.
185692	GH16_fungal_CRH1_transglycosylase	7.75e-34	88	251	13	175	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185683	Glyco_hydrolase_16	2.77e-20	71	245	14	184	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
178706	PLN03161	3.03e-11	109	218	58	165	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional
185693	GH16_laminarinase_like	1.18e-10	116	225	75	189	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96434.1|GH16	2.16e-37	82	251	855	1024
CDS13191.1|GH16	3.73e-28	65	244	43	220
QIW99574.1|CBM18|GH16_19	1.16e-17	109	244	120	249
QSS71477.1|CBM18|GH16_19	1.16e-16	109	252	123	266
QSS61834.1|CBM18|GH16_19	3.33e-16	109	252	123	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	3.97e-14	91	242	39	183	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	1.16e-07	109	220	44	152	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
3HR9_A	5.27e-07	120	218	18	118	Chain A, Beta-glucanase [Fibrobacter succinogenes]
5DZE_A	7.01e-07	109	220	43	151	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	7.08e-07	109	220	44	152	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	1.68e-14	109	244	125	256	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	4.17e-13	87	244	161	308	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q8J0P4|CRF1_ASPFU	6.91e-13	91	242	60	204	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|P32623|CRH2_YEAST	8.81e-12	109	244	127	256	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q5AJC0|UTR2_CANAL	2.14e-11	109	244	129	258	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999762	CS pos: 22-23. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in KNZ58967.1.