CAZyme Information: KNZ58156.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ58156.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	LAVV01006823|CGC1	54061.30	7.8836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01006823:21092-23441(-)

Full Sequence      

MSSLDPNNCFSAQNITRYVSVLDGPQAISRQLGKLDRSKQLGFIRKNGHRLVDVDGHTPF
KIVGPNIYWLGLDENVSPSPSYPSQTRVLEALATAAIMGSTVVRATTLGVSVGTPLSVWP
TRNSTNNDALDVISFAIYAAKRYGLRLIIPLTDQYDYYHGGYKTFLKWRSIPDSDYRVFY
DIKSDVYKDFLLYLDTLFNHVNRYTHIAIKDDPTIMMWETGNELDNPSKAWTEATAKWIH
TTAPNHLVASGRYGVSTDDLKISAIDAVTNHFYPPRADHYRADAALAASHGKVYYAGEFD
WAGRSKSWGLLGWVLVPIFLGLFALLIGGCGKVFPIVFRWTTFKAQHPGQTKPQRQRSLV
IRQAHVALFMILIVAPITAGIIYATSIKGSGIEAFLTETELPQSNGSGDLFWSLFGHDDR
CCDWVDHTDGFTMHFPGKNDDERGSVSRLMQHTYTVRRQIFSQKDNIEPKIEGDNQDWRP
P

Enzyme Prediction     

No EC number prediction in KNZ58156.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	124	301	9.5e-39	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	6.65e-04	140	294	76	223	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR49132.1|GH5	2.83e-90	20	457	6	541
CDR37878.1|GH5	5.44e-80	43	457	230	572
QBD78350.1|GH5	4.38e-73	43	458	36	359
AIC33781.1|GH5	3.43e-69	4	456	92	477
QAY67055.1|GH5	3.37e-64	43	456	7	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	4.43e-13	124	254	93	226	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	8.55e-13	124	254	79	212	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
1RH9_A	1.32e-10	126	274	80	254	Chain A, endo-beta-mannanase [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LW44|MANP_ARATH	1.38e-16	42	263	28	252	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3
sp|Q9SG95|MAN4_ARATH	4.43e-16	42	263	28	252	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1
sp|Q6Z310|MAN9_ORYSJ	5.89e-16	43	308	39	334	Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN9 PE=2 SV=2
sp|Q9FJZ3|MAN7_ARATH	6.79e-16	42	274	30	281	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
sp|Q5W6G0|MAN5_ORYSJ	3.68e-15	23	271	61	317	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
309	331
365	387