CAZyme Information: KNZ58035.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ58035.1
• CAZy Family: GH5
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A0L6VD51]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902		101494.68	7.8158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01006849:3973-7565(-)

Full Sequence      

MPSDSEELLQPQNSSESLPAHQLPSYYNNNLPARQYAPDLDQTDYRRATPTALYDYNYTH
SAPSMSPPITHQLDPFAHSIGISDQEEQGYAYDHEDEKEPSYANITLDDSNIISSPHPKT
FSSSFHPSANPHWGPAPAGRALRRNRTRKRVALTDGNLVIERPIPARLLSFLPRRGEEEF
EIMSYTAATCDPDDFESSRYTLRAAKMNRETELFVGVTMYNEDEVLFTRTMHGVMKNIAH
LCTRNKSRTWGKDGWKKVVVCIVADGRKVIHPRVLDCLAALGVYQAGVGSNMVQDQPVTA
HIYEFTTQLSVDSDLKFQGLEKGIVPTQIIFCMKERNQKKINSHRWMFNAFCPLLQPNVC
VLVDVGTKPGPRSLYHLWKCMDLNSNVGGACGEICAMKGKGWLGLLNPLVAAQNFEYKMS
NILDKPTESVFGYISVLPGAFSAYRYIALKNDEIGRGPLASYFKGETLAGRDADVFTSNM
YLAEDRILCWELVAKRGHNWVLKYVKSAWGETDVPNEVPEFISQRRRWLNGSFFAAIYSL
AHIGQMSRTEHSRKKALALYFEGFYNFLNLLFAWFGLANYYIFFVLLSSSLEDPSLKMPK
AVTIINTLLHHLYTGTLIGCFLLSMGNRPQGAKWTYIAAMVIFAFLALYMLVACVLILVK
AVKGGANATLYAQIVISLVATLGSWITSSVLALEPWHLITCMLQYLLLAPAYINVLNVYA
FANLHDFSWGTKDHNIILTDLGVAVSAGDSKVEITCPLEQKDLDQNYDEALLNLKTRPKL
LEKNRSDKEKEALKQDYYKSVRTNVVLLWTLTNVCLSLSHERERPILIGRLFLLGYFGRV
HFGWGCSRVVCVGQSQPEGATLHDHHPGFCRIHGFDPARRIDSLLGHPSLCRVIPPILVV
PT

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	219	381	2.1e-78	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.26e-116	219	381	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.72e-97	215	535	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	4.95e-32	150	218	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.19e-28	330	734	115	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	2.07e-19	360	730	205	490	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX60522.1|GT2	0.0	49	813	159	916
CDI51403.1|GT2	0.0	68	813	183	940
CDU24095.1|GT2	0.0	132	813	288	972
SAM68746.1|GT2	0.0	132	813	264	948
ANG56502.1|GT2	0.0	132	817	262	950

PDB Hits     

KNZ58035.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99126|CHS3_USTMA	0.0	132	817	287	975	Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS3 PE=3 SV=2
sp|Q99127|CHS4_USTMA	3.76e-282	140	831	210	915	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|J9VGT6|CHS8_CRYNH	3.17e-271	130	813	290	980	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|P87073|CHS1_PHYB8	1.20e-270	127	823	83	795	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	6.91e-269	140	816	110	804	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

Start	End
527	544
565	587
602	624
637	659
669	691
698	720