CAZyme Information: KNZ57934.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ57934.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		67954.81	8.3428

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01006881:10365-12528(+)

Full Sequence      

MECPGYSPSFQPSLISNDHPAPSCNQILNEKSAPLGKPSHHPFLAHSPSKPQPGCISPTI
SAIGSSRRRSWVDYLLVLLVLVTVGTVVVLSTVNYYVGIYPSDVILPSELEAEPLRPSRV
PKIIHQTWKTDQIPDRWIPVRESCVAAHESWEYMLWTDKSGRELIEREYSWFLPIYDGYR
YPIQRADAVRYFILHHYGGVYMDLDIGCLRPMDSLLRFDLVLPQTVPVGISNDLMFSAKE
HPFMDFIIHRLGQFDHDYHLNYATVMFSTGPMALSALLNMFRRSPSFGLTPGLPAFGPVR
ILPPKLYGKNLVAPQPSPGPYFTHYYGSSWHTDGAGLVLWLGKFGIFGLYGGILVVLLYG
LRVAFKCCRPQTAASEGVLSSSWSTVSLPVKSRRSAGTLWKRRLMKVRRTDSRLADDLLL
PGHLLGKVTSNSPKPSRSHRTHYQKDCMQCNSCTMAHGLLDSAHQLPLYESRPLHCLSCG
RRPRKSNRSDSSPADDDWEEIDEDTALLSSTSTSNLMSNPTPVLLPSTPAFYRSPNPAPL
ALPSLRVELNQEVAPGLPSPLLNAIYRLAEMAGIVSENGQRSDIHSNSPTRPDDTTLLSG
ARPNSDRKVD

Enzyme Prediction     

No EC number prediction in KNZ57934.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	140	216	1.5e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.06e-48	120	358	82	309	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.78e-25	134	222	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI52367.1|GT32	2.01e-93	66	361	6	341
CDR87151.1|GT32	1.41e-89	101	361	93	369
SJX61564.1|GT32	2.62e-88	113	361	120	371
CBQ71693.1|GT32	7.18e-88	113	361	120	371
SAM79788.1|GT32	1.87e-87	66	361	6	367

PDB Hits     

KNZ57934.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.74e-61	85	387	24	314	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.42e-58	108	343	74	294	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.38e-57	103	376	54	310	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	3.98e-56	103	351	37	283	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.52e-51	117	351	59	291	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
75	97
259	281
337	359