CAZyme Information: KNZ56061.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ56061.1
• CAZy Family: GH37
• CAZyme Description: GH131_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0L6V5I8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		35625.61	9.5208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01007395:16097-17727(-)

Full Sequence      

MLYTSRPASWASLLLLISLSALVVPNLSKLVVDYRVPLTAKVADLDNPASALGKLTQFKI
IGNNSVTQAYKFQKTPNGKFQSITFIINDNSIFKPDNNTKNDQIGFRRNDLLPKYDAKAI
EVGKKTYHHSFIFKKGLNNKHGYLIASVEFPKAVSAHIFDLHYGNAFKSENTAGTLSPDA
NKIKLRDINFETIFSVEMVVNKVFNFAVEIDVSLNLVINLRAFHSIGNDKLAEVVKSTPI
KPKNEKAANVAGTGEWHLQMIKEPLPDPKDAEKDRSDIPHKGIQETGIKEQLIQLRNFIE
DTTTEPGSTDPDGPTGTSSTSS

Enzyme Prediction     

No EC number prediction in KNZ56061.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	31	303	7.3e-30	0.9607843137254902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.12e-58	30	304	1	250	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40783.1|GH131	2.83e-77	29	319	25	311
QRV95300.1|GH131	1.21e-24	81	300	83	295
QRW09714.1|GH131	8.53e-24	81	300	83	295
QRV80910.1|GH131	8.53e-24	81	300	83	295
QRW22550.1|GH131	1.01e-20	81	303	81	296

PDB Hits     

KNZ56061.1 has no PDB hit.

Swiss-Prot Hits     

KNZ56061.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.507887	0.492101

TMHMM  Annotations     

Start	End
10	32