CAZyme Information: KNZ51173.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ51173.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1749		195221.43	5.4592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01009124:7829-14902(-)

Full Sequence      

MKRLRGLRKRLGLLLILSSGVLAGSPPISVSIQATWQEPPMLVQVLESATLERPGVLFSA
LDAVCTSWEDGKSKLSTDQQTYEYLMSLLRSPGLLDGPGEIESLAFSIALKEAQPKIEAF
RAWYASLPSNLTAPIESQDNAAGSKTDDCKSWALINDSKVCDFSKLTQLLESKHLAEKIQ
PQPQVLPFDHQQGRSSPKSRVPIVILYASPDPGSLCPFHRVLHATSKKHQPGATYIFRWK
ISSVPSTSSKSSLLSGWGASLDIKKSEYLTLDDRPVESSSKEDFQLVIDGTKQPAGTEVQ
VVSEQAKLKPLKAAEIFDIGAKAAQHVLSSPSPLSALRHLTEDFPLIAHALVNEWVPGRI
SRELRGELQENIANGIPAGQSAVWMNGLQLSSLVSLENLNFFKLVEIMRSERRWIALLTS
LGINSLQARTLIVDEKLNLAMNPEAASALEVGEIDASTLGVRFDASDRQEGGGAIIWFND
LENDDRYSMWPTTLRAILRPTFPGQLHAIGRNLINVVLGLDLTQRKNLHTLGHVIELMIS
RNLPIRWGVVPIPTGNTSEGEKMSRYLWDMIEAVGPMETLKFMKEFTVSLEPQAETIDVE
QFSAKASELVSSEKKSPEEAQAHERKFQNWLNKSQQYSSRLSLCSNDNSIPACMLINGRF
FPMEEVGLINCITLSCIYCNALICFFSSALAQNYRSHLQETATLHIGFLQHQVYFNLLKD
DASVADYLYDLPMVHRARNDLVFPSETRPLQFVNLVEALQSTDVLAASTFFQNSALPRND
DQPIASLWVVGNLDSSIGISAVAATLGLLVCMRSSSDTFIQVSFVHTPPEDSDTPTEVSA
RLAALLSPAIDEKIKTSDLLDLLDRHGYRVIVSDDSDLGIELVLKKVQAEGSDVAGTNDQ
PAWAGTREFARTLGVQSDDLAVIINGRILHVSPGTKLLSEDLVLLVEYETQQRIGTLMEA
LRSLNDFDLAQHYSKVPLIMCTVGFVLVGSNDGFGLSSSSETRSAKHLSRDGQYSSFKHG
DEQAALFEFGVILNPASEAAQRWSALLETLSHRSDVAIKIWFNPSLELNELPIKRFFRSA
IWNSLEFDKNGRAIPALVNFRGIPTETLFTLAIDTPPAWLALPHDSIHDLDNIMLSELPS
AYSSQGVEAIFQLDHIILAGHAREVPSDIPPRGLQVVLSDLLRNQEVDTIIMANLGYFQF
KSAPGLHRLSIRPGRSLELYQFQSTDSESENNEAYQLLSLTTFNGLTIYPRVRKRPDKTS
ETLIEPLSTSSKKNPGREFSKIMGQVKDLAAGMLKNQGFDLASRAAPSIINVFTVASGLL
YEMIFPPANGVFDVCQCHASHPQSVWFISNFLSPSFKRFIPHLAREYGFDYQLVTYRWPS
WLRAQKEKQRVIWGYKILFLDVLFPLEVDRVIFVDSDQVISECNIDFWDRSGLNLAFLSV
QQIVRTDLKALVDLDMEGAPYAYPPMCNDRNETKGFRFWDTGYWKESLQGRPYHIRYIYL
FTALYVVDLRVFRTVAAGDLLRQHYQALSADPGSLANLDQDLPNNMQGMLPIFTLEQSWL
WCETWCSDEGLKTAKTIGARERYEYLMLLPFFGHKYADLCNNPLTHEPKLKRARRLIPEW
EEYDQEVAALAARIKKNHAGEFSSKITVQAGEKIDDGKDHYDHPKENHDDVKPSKGLADD
DLDSSVWSLHGEEGLCDLGQASKCEILVTDKSAIFRKTIPVKVCVYESISQRSSLDIEKS
LNVVPGMDF

Enzyme Prediction     

EC	2.4.1.-:29	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1435	1578	3.7e-58	0.5524193548387096
GT24	1310	1428	1.5e-37	0.4637096774193548

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	6.46e-169	1310	1630	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	9.89e-135	1310	1610	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	9.29e-65	463	742	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	4.23e-39	1160	1265	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408199	Thioredoxin_12	6.94e-38	38	241	1	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47046.1|GT24	1.15e-280	25	1640	23	1640
QRV90671.1|GT24	8.48e-272	25	1631	23	1531
QRV75871.1|GT24	1.67e-271	25	1631	23	1531
KGB74213.2|GT24	1.65e-265	25	1658	20	1559
AUB22656.1|GT24	2.31e-265	15	1648	8	1549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	7.04e-252	19	1636	2	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.71e-251	19	1636	2	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	7.44e-251	19	1636	2	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	5.09e-216	25	1552	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	2.17e-187	738	1636	401	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.93e-195	27	1645	21	1439	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.14e-176	6	1636	20	1529	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	1.32e-173	2	1630	16	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	9.17e-173	2	1630	16	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	7.11e-168	17	1630	24	1498	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008808	0.991158	CS pos: 23-24. Pr: 0.9470

TMHMM  Annotations     

Start	End
13	35