CAZyme Information: KNZ48861.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ48861.1
• CAZy Family: GH13
• CAZyme Description: Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A0L6UK05]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		50376.84	10.0890

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01010564:5294-7370(+)

Full Sequence      

MSPRLTATREHVKRILLTKDRYTLVAAMLLLAEGLLITAIIKYVRYTEIDWVAYTQQIRG
YSHGERNYLKLKGDTGPLVYPAGFVHVYSVLYSLTQQGQDVKLAQYLFGVVYLITMGFVL
AIYKHCHSVSSYTLCDLPTYAVLSLILSKRLHSIYVLRLFNDGVAMMALYISIWCLVTRR
WNWSALWFSLALSIKMNILLFFPAFGFIYFQMVGLLRTMNLILIIALLQVCLAMPFLMGF
PREYLSKAFEFKRVFEYQWTVNWRMMSTSTFLSPGFATLLTALHLSTLVWFAWTRWSRAF
GEDGLISLVVRGLKNWTAPAAKRPKDLTPDYMVKVCFTCNLIGIICARTLHYQFYSWYAH
QIVFLAWQTPYPVLVRLVLMMAIEYSWNVFPATAKSSMILFMSNLLLLLGTWWSSDRPSS
YSTTPRVSKKKHKQT

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	27	397	1.5e-130	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	29	397	3	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08832.1|GT58	2.08e-96	13	416	12	401
UIZ28023.1|GT58	6.85e-92	26	421	47	424
CAB3221215.1|GT58	7.24e-92	9	412	7	408
SVE75713.1|GT58	1.53e-91	8	413	31	414
QHN84717.1|GT58	4.24e-91	26	420	45	449

PDB Hits     

KNZ48861.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q55F69|ALG3_DICDI	4.36e-92	22	409	19	419	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|Q92685|ALG3_HUMAN	2.40e-89	13	432	32	438	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q8K2A8|ALG3_MOUSE	9.51e-89	15	432	34	438	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|O82244|ALG3_ARATH	3.77e-88	26	412	36	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q27333|NT56_DROME	1.56e-86	13	410	36	483	Lethal(2)neighbour of tid protein OS=Drosophila melanogaster OX=7227 GN=l(2)not PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000008

TMHMM  Annotations     

Start	End
22	44
77	94
106	123
155	177
186	208
218	240
271	293
357	379
392	414