CAZyme Information: KNZ48758.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ48758.1
• CAZy Family: GH105
• CAZyme Description: Glyco_transf_20 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0L6UJR9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1070		119872.34	7.0752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01010642:11982-16421(+)

Full Sequence      

MYDRAQVHYGLGQERPDEDDWEPPQLDGLPELANIRHRVNLIEDEIKSKAATSPPGSQSA
SSSSNNANSRFRQSIEIRPGDLLTHPQSLHSPTCSPIPPSGALKTSSLLDSSQPGPNTVT
SLTSKPASPTQPKSEPKDPPTVSNDEPNGPPFKWILQPRRGHAALNAGIKSLSNYRSITL
CAYPADIRIASNLASHTEPIEASKLSEAQKLSLDSGLRLLARSAPENPTEDSQSDALKKG
IECVPVWADDRSAALHYEGFCKKYLWPIFHYMPLSEHQDKKEENLAWKAYEEVNYAFAKR
IASVYQPGDLIWIQDYQYVQFPCSYYLLLVPRMLRKMMPKCHVGLFLHSPFPSSEFFRCL
PRREEILDGMLGADLLCFQTYSYGRHFISACIRVMGLESVGNGIECNGMITDITYCPIGI
DADRIEVEKLARHFFSFFKRLPGVRPKMDALRKLYEDKKIIIGRDKLDPTKGVLHKLKAF
EYLLKNYPQWRNRVVLIQVTSPSPTDSPQLATKISELVDHINATYGTLHFQPVHHYHQTI
ERDVSEYFALLSVADLAVITSIRDGMNTTSMEYTICQEENKNPLILSEFTGVTGSMKSAV
KVNPWDLGDVARAIDQCLNMSQEEKVARHAQLHSRVKSHSSSVWASTLLLQLLQCLRSDQ
TKESVKLLNEEDMVKKYKQANKRLLLFDYDVCQSSNLAFTYSTYSFDHGTLTPIVKNPKD
AVPPEGLIEALERLCADKRNIVYIISGRDGSFLQKHLGSISGLGMSAEHGCFLREPGGKE
WIDLTENIDMSWMDDVEEIFKYYEARTLGAFVEKKLSSVTWHYRNADPQFGLFQAKECQA
LLESLQERMPIDILKGKKNIECRPAHTNKGEIVKRLLYTSPDVEFALCVGDDKTDEDMFR
ALKMLRSNASLDGHTVGQVHSTTIDPPQTLSLYPILARSSSIGPGSHSSLDGPAAKRPLR
RRYSSNNSIRTSNSRQNSPVPAAHVHQFGLNPTSTTAVSVPMKASSTVGSTVHPSPKLEP
VESVLEPESIFSLVIDENESRKTLAEYRLDRPLQLVAVLDRLSKLSSEPA

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	227	652	4.3e-146	0.8505263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	226	902	56	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	194	647	5	457	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.43e-167	195	647	7	463	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	1.60e-159	225	1067	147	931	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.13e-144	226	647	68	472	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR41528.1|GT20	4.56e-310	75	1067	122	1015
UOP56917.1|GT20	6.04e-259	147	902	319	1092
CED83290.1|GT20	8.03e-258	152	950	125	873
SAM82706.1|GT20	6.80e-257	140	932	423	1240
CDI54066.1|GT20	1.68e-256	145	940	442	1260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.81e-114	245	653	137	524	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUV_A	2.59e-91	230	655	59	470	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	2.59e-91	230	655	59	470	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	1.26e-90	237	652	65	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.37e-90	237	655	76	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	7.28e-162	153	902	58	770	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	6.90e-161	205	907	98	797	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q54NU9|TPSB_DICDI	4.59e-153	246	902	128	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9P4D3|TPS2_ZYGRO	7.51e-151	245	902	141	799	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	9.21e-147	233	922	162	794	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KNZ48758.1.