CAZyme Information: KNZ47060.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ47060.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		28915.36	9.6814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01012062:47197-48461(+)

Full Sequence      

MAAAPGSGFGRMGAPGSRFGGSGTNMAAPGIGSGATGTGASGSGGGTTGVGGSNVHRLFD
FRLTNNMQTADLDNPNSALRRLITYIVKGAASASQYVAVVPRPYYSPELLIRIRDDSIFV
PGGNPANAQNGFRRTDVLPAINKATALSGVTTFYQVGDHVWDIFAGSDFDSQNTAHMPSR
NSQTIRVRDLRTNTLYSLPLSYDQDYNFAITVDWSANMLTVYASTGNSPLRRVAGPNSND
PKAASSSGQGEYHLQLIKLHVALRTLLLSPPLLC

Enzyme Prediction     

No EC number prediction in KNZ47060.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	163	262	5.5e-16	0.36470588235294116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	8.65e-41	58	259	2	217	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV95300.1|GH131	6.52e-33	58	262	22	262
QRV80910.1|GH131	1.00e-30	58	262	22	262
QRW22550.1|GH131	2.62e-30	58	262	22	260
QRW09714.1|GH131	3.81e-30	58	262	22	262
ALL40783.1|GH131	5.68e-28	60	258	29	254

PDB Hits     

KNZ47060.1 has no PDB hit.

Swiss-Prot Hits     

KNZ47060.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000011

TMHMM  Annotations     

There is no transmembrane helices in KNZ47060.1.