CAZyme Information: KNZ45676.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ45676.1
• CAZy Family: AA9
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A0L6UAX5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		79595.17	9.5143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01013405:17023-20171(-)

Full Sequence      

MSHAPKYALTRGWGYSFNAASRGAWAGGLRRVIFGSFCVVIVEISVSVADRPGCILTTVG
ELWCKPCRGQHHGIGSSFGEASNGSQQVFHSELQHTIYHLTPRLMSTPTKQPSTHQTQNP
APSILITHPSRCLKPRPIAAFILIIILCYALSHSPFRSSPNKHPFALQPIVPPAASQLDQ
QSQIRHAFLRTFRLYTQPDQSYRGKSIHPFAASPDPYPETTGATIIDSLTALHIMNLSEE
FQDALNHTIHLDFQSSDRSDQDIPDPEAMIRSLGAILSTQGLIKSNHTTLLFKAQQIADR
ILNSWNFNQSAAPYPWLRLGIHSQHEENKPLTVAQAVSSYIVFLWLEGSIALEFNRLSHW
LGNDSYRVRADQASRDIMNHPPSFPGRHSPTLTASTGPPVDEIVRWGATLNSFLEYGIKY
WQLVGEPAMYYMSHWQDTVDTLIQDILQWSPGTSLPYLAGYSQVRGGNASDMSQLSCFAP
SSWMLGGKLLKNEAIFMLGTFGLGMAETCYQAEHSSGGTNVSHHPPHKTKKSKRSFANES
LDLQNHADDEKNHMPRYLRPEVAQNLWYAWRLTGDVKWQERAWAIFQASELHFKNTGGYL
APHQPRASHSTKQNSSRIFQGFYLPTSPFILSREKGRSVSKQMKLTSFSFDSLPSKKKNS
VFIFDVHGAGLFLVRRKGNFGSSATHAHPFRIDPDRQLGNLREFIEKLRA

Enzyme Prediction     

No EC number prediction in KNZ45676.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	205	614	7.8e-53	0.8721973094170403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	9.21e-57	222	599	34	398	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.92e-41	151	624	41	485	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV91005.1|GH47	1.18e-39	222	599	34	402
QRV76191.1|GH47	1.18e-39	222	599	34	402
QRW05096.1|GH47	2.97e-39	222	599	34	402
CBQ72197.1|GH47	1.09e-34	222	619	81	468
SJX62068.1|GH47	3.60e-34	222	619	81	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	6.77e-19	222	624	65	434	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	7.16e-19	222	624	63	432	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
1HCU_A	7.65e-17	207	590	40	422	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
2RI8_A	2.09e-16	222	601	45	414	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	2.44e-16	222	601	80	449	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	1.69e-24	222	600	138	485	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	3.71e-24	222	600	137	484	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|E9CXX8|MNS1B_COCPS	1.20e-23	199	601	62	454	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	2.62e-22	184	599	43	446	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	8.29e-21	184	599	44	447	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986309	0.013697

TMHMM  Annotations     

There is no transmembrane helices in KNZ45676.1.