CAZyme Information: KNZ44524.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ44524.1
• CAZy Family: AA3
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46899.51	7.0022

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01014693:6968-8993(-)

Full Sequence      

MTGYEAAQRQVDWFTDAGMMEGFKKLITFLLDRTNTVNGVRYGDDDTVLAFETGNELNWA
DPSHVSFLRPPPAQWTLEIAQHIKSLAPRTLVMDGSYSRKNSSFWEPDVLDSQYVDLFSY
HLYGEGELKAYPALHKEVRAHGKTLIIGEHGFYADIETYEAAYQEFDCAGALIWSLRGHS
QQSGFDTHSEGNNIFSYHAPGWLNQTSASFDTQESAVVSATYNASYAVLGLDPPPKPAPG
KPEPFFVTNGTHAGLSWRGASWASRYEIFGGYLEGMSFKLISNQVQDNVAAGEVFVPLDP
RQPTKVLVLPPRRQFNVHMPHGGWTDMKWCFPGSGCWRQTHNHSISSSLFSNHSLLPSFN
HTTPKLSPLPLMLPSSTRKRSLQGAWFSVRALNDDGRHGKRSKALFLKSNWFHSLSSQS

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	9	184	6.3e-33	0.63671875

CDD Domains     

KNZ44524.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	1.13e-71	1	246	71	341
ALL40758.1|GH5	9.61e-68	91	405	1	319
CDR43041.1|GH5	1.54e-65	9	298	190	479
ABR27262.1|GH5_41	1.60e-33	4	287	145	410
AYQ73430.1|CBM23|CBM61|GH5	2.59e-29	5	292	189	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QP0_A	2.25e-10	12	194	131	345	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3PZ9_A	4.28e-08	12	186	144	352	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	6.21e-08	12	186	130	338	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

KNZ44524.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KNZ44524.1.