CAZyme Information: KNZ44220.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ44220.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	LAVV01015049|CGC1	42364.64	5.6217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01015049:3214-5358(+)

Full Sequence      

MDGDITDPAFESPESLQPSNAFPDPMRPSVREFPESLPSSHEVLLSSKPSPKKYSVLVVF
GDSYSDNGHPRAPEYQFSLAAKPAVGGRYSDGPVWDEYLAQKLSSSEDTNITFLNYAYNG
AHINNKLSNSSSKPVPDTADQIQTYLTELAKYVKHPISQEVFDARILHTVWVGINPIISI
WRSTSLVNQTLHSDSFLTPELVKKLDAQVSEVSKQLKLLLDNPSLSNTILLKKQLNHLQK
LVEVAHKSNRRQKIAQDLETLENAPIQESRVIVFDTATLWNDVRSEPQKFGIDSFGSCYD
NTNKPPCPQPGHFMYWPSRISSTDLTNEQFNPNILNCLSKVDLTWKMAFEPDGNLGWVSF
LSFLIRRYPEEQKYD

Enzyme Prediction     

No EC number prediction in KNZ44220.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	57	301	7.2e-22	0.8726591760299626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.12e-31	57	316	2	250	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238883	Triacylglycerol_lipase_like	4.85e-16	54	311	1	239	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	5.93e-11	48	308	23	287	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA67938.1|CE16	5.06e-12	45	316	24	263
URD49815.1|CE0	1.42e-08	54	323	33	276
QRW26348.1|CE0	1.80e-08	52	316	59	293
BDA67779.1|CE16	1.02e-07	55	292	47	264
CDZ97456.1|CE0	2.95e-07	54	320	79	340

PDB Hits     

KNZ44220.1 has no PDB hit.

Swiss-Prot Hits     

KNZ44220.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KNZ44220.1.