CAZyme Information: KNZ43879.1

Basic Information

• Species: Puccinia sorghi
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia sorghi
• CAZyme ID: KNZ43879.1
• CAZy Family: AA1
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A0L6U5U3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		73016.92	7.3816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsorghiRO10H11247	21769	N/A	691	21078

• Gene Location: location=LAVV01015458:4852-7460(+)

Full Sequence      

MRLPRLISSGLMLYATSYTMSRTEAAQASSGKKSMKRPTTPSWQHNTLKSFVSRNLDLSL
QYPDRTCRRPVDVPEEEGPADGGHQRRDLPSFSYPFTFSNVVSPRARLGQLVVNPAPYVQ
PAPQLILSSQKSTNRLSQPSLLSSPQSILPSSPALTLQAPALLAPFSAPIAASYFPDWSL
DILSPEQILYRKFDIIYFAFGIPNERFGVDFTQPDSLDTLDKLVRYAHGNGTRVVLSVGG
WGGSKFFSVAVKSETSRLTFVDNLYQLLVAHNLDGIDIDWEYPGQAQIQDNIVSSTDSAA
LLDFFQLLRARLGTGKIISAAVTDYTFLNSQGGRMTDVVEFGKVLDYILIMNYDVWGTTA
NPGSNAPFSNGCEDSSQPGANMVSAIKTWTSAGFPRQKILMGLAAYGYINHASATTLVHR
KRDGDIPQINRRFNQYLSQARKRQNACSEPSSGGAPCPSPNSPPPPPQSTAQTPAPANSN
QTSAPSVDQDILPSINQTRTANINQTQNVEANLTTTTNATSAEPNLTTTPPSAEPNSTTP
TTTSPVFVEPGQNDTAGQVRTASSGVGSGNMEEFSGSQIQFKDLFKWGVVALANSEGRLD
GINGYQVAWDRCSSTPYVFSKARNILITYDDPISIGIKASYALAAGIGGVGFWDMTGDHK
SMLIDAARVNLAKVP

Enzyme Prediction     

No EC number prediction in KNZ43879.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	173	661	1e-49	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.57e-41	172	408	3	238	Glyco_18 domain.
395573	Glyco_hydro_18	2.53e-36	174	408	5	225	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.05e-34	174	407	4	263	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119357	GH18_zymocin_alpha	2.08e-33	174	407	5	242	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119349	GH18_chitinase-like	1.31e-29	170	355	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR49082.1|GH18	3.71e-90	170	658	300	762
QRV87962.1|GH18	9.25e-80	169	671	122	504
QRV73087.1|GH18	1.81e-79	169	671	122	504
QRW02133.1|GH18	6.09e-79	169	671	156	538
AGV14596.1|GH18	4.86e-78	174	671	451	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.75e-29	172	410	5	239	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
4AY1_A	9.65e-21	174	424	7	263	Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_B Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_C Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_D Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_E Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_F Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_G Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_H Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_I Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_J Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_K Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_L Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens]
6TSB_AAA	1.79e-20	184	423	45	278	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	2.23e-20	184	423	64	297	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
4P8U_A	3.38e-20	174	424	13	269	The crystal structures of YKL-39 in the absence of chitooligosaccharides was solved to resolutions of 2.4 angstrom [Homo sapiens],4P8V_A The crystal structures of YKL-39 in the presence of chitooligosaccharides (GlcNAc2) were solved to resolutions of 1.5 angstrom [Homo sapiens],4P8W_A The crystal structures of YKL-39 in the presence of chitooligosaccharides (GlcNAc4) were solved to resolutions of 1.9 angstrom [Homo sapiens],4P8X_A The crystal structures of YKL-39 in the presence of chitooligosaccharides (GlcNAc6) were solved to resolutions of 2.48 angstrom [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q15782|CH3L2_HUMAN	6.68e-20	174	424	32	288	Chitinase-3-like protein 2 OS=Homo sapiens OX=9606 GN=CHI3L2 PE=1 SV=1
sp|P09805|KTXA_KLULA	4.63e-19	183	407	398	613	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q11174|CHIT_CAEEL	8.75e-16	155	414	39	313	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
sp|A0A1B1J8Z2|CHIT5_LOTJA	1.07e-15	165	407	50	289	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2
sp|P32470|CHI1_APHAL	5.45e-15	233	407	123	294	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000085

TMHMM  Annotations     

There is no transmembrane helices in KNZ43879.1.