CAZyme Information: KNE01154.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: KNE01154.1
• CAZy Family: GT48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	LGST01000016|CGC5	47774.16	4.7968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cauris6684	8301	N/A	840	7461

• Gene Location: location=LGST01000016:511338-512588(-)

Full Sequence      

MKLFNLLSLATSALAATTFRRGNNKGVNWDYENKLVQGVNLGGWFVLEPYITPSLFKDCV
GTVPVDEYHYTKSLGKDEAKKRLQQHWDTWYTEDDFKAIADAGLNTVRIPIGYWAYDLLD
DDPYVQGQDYYLERAIGWARKHGLAVWIDLHGAPGSQNGFDNSGLRDQIEFQTDENIALT
LTALQKIFDKYGGSDNEDVVSGIQLLNEPLGPSADMNQLKNFYYWGYNNMRSVSYNNVII
HDAFMQTDGYWDSFMNVKDGYWKVVLDHHHYQVFSAGELAMDINKHIETACSWGPKHQKE
YHWNVIGEWSAALTDCAFWLNGVGRGARWSGDYDNSPKYGSCDPYTSATTWTDEHKKNVR
KYLEAQLDAYSTASGWIFWNWKCEDAVDWDMSELIKIGVFPQPLNDRQYPNQCVYS

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	85	384	1.7e-125	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.21e-78	35	413	17	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.63e-07	86	240	15	164	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW21995.1|GH5_9	0.0	1	416	1	416
QRG36728.1|GH5_9	0.0	1	416	1	416
QEO20957.1|GH5_9	0.0	1	416	1	416
QEL58803.1|GH5_9	0.0	1	416	1	416
QWU86673.1|GH5_9	4.35e-265	1	415	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	2.63e-189	22	413	1	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	7.51e-189	22	413	1	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	7.51e-189	22	413	1	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	1.22e-188	29	413	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	2.15e-188	22	413	1	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NKF9|EXG_CANOL	1.94e-194	9	415	11	425	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|Q12700|EXG_SCHOC	1.12e-193	25	413	31	423	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|P29717|EXG1_CANAL	2.75e-190	19	413	36	435	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|O93983|EXG2_WICAO	1.24e-176	4	413	6	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q875R9|EXG_LACK1	3.46e-162	19	413	31	437	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000509	0.999458	CS pos: 15-16. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in KNE01154.1.