CAZyme Information: KLU92953.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU92953.1
• CAZy Family: GT59
• CAZyme Description: cellulose-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		23129.36	8.5010

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL877033:852-1657(-)

Full Sequence      

MSNEHVLTLKIVPLGDSITEITCWRALLWDNLVAAGVSSQVQFVGSTTSNTMNCRAKDAA
WDKRHEGHSGFLAVDIARNNLPGWLRQNKPDIVNFMLGTNDVSRGKTTTDIISAYTSIVT
QLRGANPKVKIIIDTVIPLSFGQAGITAINNQIPTWAAQQNKTDSPIYVLDVANGYPASA
NRDGVHPNAQGDQIIASKLSPLLIQLIKESIKQ

Enzyme Prediction     

EC	3.1.1.6:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	9	197	7e-55	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.18e-40	9	196	1	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	4.31e-16	11	199	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	6.41e-16	14	194	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238860	Lysophospholipase_L1_like	2.43e-13	10	203	2	176	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
238866	sialate_O-acetylesterase_like2	3.90e-12	89	203	48	168	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60834.1|CE3	1.30e-93	10	213	24	228
AEO64701.1|CE3	3.93e-84	1	211	23	234
AEO59370.1|CE3	1.12e-83	1	213	23	235
VBB79507.1|CE3	1.42e-80	4	211	83	291
CDP27869.1|CE3	1.42e-80	4	211	83	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	1.78e-67	10	209	3	205	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	5.08e-67	10	209	3	205	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
2VPT_A	3.39e-11	8	197	5	189	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	6.22e-07	8	191	43	248	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KLU92953.1.