CAZyme Information: KLU92703.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU92703.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		52431.01	5.3265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876984:88144-89724(+)

Full Sequence      

MTRLFELGAALVAAAFAVTSASARVLAPRAATVFEAEDAALVGTAVAKELAGYSGKGYVG
GFDADGDKITFTVPSDEARLYNLNIRYAGIYGEKRATLRYNGGSDTEILLKATASWETVS
GGQVLLNKGENKIEILNNWGWYLIDYISIEATTPRGPHDINASLNNPKASTEAKALYSYL
RSIYGNKILSGQQDLKWADYVTQQTGKTPALLAVDLIDYTPSRVEHGTKGASVEDAIAHH
ARGGIVSVLWHWNAPAGLYDTAEQPWWSGFYTRATDFDVSRAMADTTNANYTLLVRDVDA
IAGQLKRLRDAGVAVLWRPLHEAEGAWFWWGAKGPEPCKKLWAMVHDRLTNHHGLDNLIW
VWNSARPEWYPGDETVDILSADVYAKGNGPMSLQYNELVTLGRDKKLIAAAEVGSVPKPE
LLKAYQAQWLWFCVWEDGYINNKDYNDPAVLKAVYNDDYVLTLDEIQGWAKTGGGK

Enzyme Prediction     

EC	3.2.1.78:14	3.2.1.151:5	3.2.1.4:3	3.2.1.78:13	3.2.1.151:5	3.2.1.4:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	166	465	2.4e-108	0.9933993399339934
CBM35	34	149	2.7e-32	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396639	Glyco_hydro_26	1.80e-78	166	465	2	311	Glycosyl hydrolase family 26.
271152	CBM35_mannanase-like	1.01e-52	32	150	1	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
293595	CBM_35	1.14e-22	33	151	1	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
271149	CBM35_Lmo2446-like	5.69e-18	32	138	1	111	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
226609	ManB2	1.33e-15	218	429	86	307	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG24384.1|CBM35|GH26	6.10e-236	34	472	49	487
AAQ31840.1|CBM35|GH26|3.2.1.78	4.72e-233	34	469	49	484
AEO53670.1|CBM35|GH26	4.41e-232	31	469	41	479
VBB80704.1|CBM35|GH26	1.23e-228	1	469	1	467
CAP61906.1|CBM35|GH26|3.2.1.78	4.97e-228	1	469	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.74e-228	34	469	15	450	Chain A, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.29e-109	166	466	8	310	Structure of Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.53e-59	159	469	29	355	Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	2.05e-49	154	467	16	328	The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	1.85e-48	160	449	41	327	The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q4H7|MA26A_MYCTT	7.83e-233	31	469	41	479	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
sp|P49425|MANA_RHOM4	1.90e-113	35	469	20	460	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
sp|Q5AWB7|MANE_EMENI	1.88e-104	166	469	30	353	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
sp|A2R6F5|MA26A_ASPNC	1.47e-92	169	464	33	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
sp|P55298|MANC_PIRSP	7.00e-85	33	466	22	459	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000360	0.999632	CS pos: 23-24. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in KLU92703.1.