CAZyme Information: KLU92623.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU92623.1
• CAZy Family: GT39
• CAZyme Description: initiation-specific alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	GL876982|CGC1	47642.26	6.8623

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876982:195788-197056(-)

Full Sequence      

MGAPPLLGSPLSPLSPRLTIPSPMRNRLPTQIRRCLPLYLVGLCVVLLMFNADLVGINLP
RSHRLNIRREAYKDYLNAKAGHNGASAPKTPAKFPRKVWQTWKVDPLSFAERDSLTARTW
TARNPDYRYEVLTDDNDMAYVEDHFGPDGFDRPDIVDFYRNVNATIIKADLLRYIIMYAE
GGVYADIDVEALKPAHRFIPERYAEEDVDLVIGVEVDQPQYKDHPILGSKSMSFCQWTFM
AKPRLPVMLHLIENIMGWLDGVAVEQGVAISEVQLDFDKVISGTGPSAFTQAVLEDMNMR
RKLDASSGAVSKKRGPYTWDDFHDLDESKVVSRILVLDVEAFAAGQGHSDSGNHNARGAL
VKHHYHASNWPSRHPRFSHPAYGSVERCNWEPACVAKWDQDVAEFKKLSAEEQQKIIAAR
QF

Enzyme Prediction     

No EC number prediction in KLU92623.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	200	2.1e-18	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.91e-22	72	255	60	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.59e-11	111	194	2	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60802.1|GT32	2.77e-247	1	422	1	435
UQC86260.1|GT32	2.40e-190	9	417	7	390
AEO66402.1|GT32	8.93e-187	7	417	5	390
AEO60901.1|GT32	7.64e-183	7	417	5	389
QYS97060.1|GT32	1.93e-182	7	417	1	384

PDB Hits     

KLU92623.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.12e-33	92	370	140	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.14e-29	94	363	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.70e-27	93	337	129	356	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	8.15e-26	92	363	94	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	7.30e-08	33	194	3	158	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000040

TMHMM  Annotations     

Start	End
35	57