CAZyme Information: KLU92371.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU92371.1
• CAZy Family: PL20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		55263.09	6.1484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876980:280650-282149(-)

Full Sequence      

MLVSFRSQRLLPLAAFLVFGVLLLILKAPRFRTSPFRYPFQTGPGSLFPVLTPAQVGAAG
GCDSDIAPLSSLGLSEEILYTRRCIKPVFDDAPHPLSRGAVGEIQQPLIDTQVAVNLSSP
CFHEGTLPSCAPIALRVPPPYPKRTYPHLIFGISTTYNRLRESLPVFSHWLSASGALLVA
VVVDADDAPEGKSKTPRDLQALERLYQDSDMRLHCVKTRNSSLTVDQNHFTVILDMLEAV
TPQTKWLGLLDDDTFFPSLYNLDRALSLHNAEESTWLGALSEDLEAVRNWGIMAFGGAGV
FLSVPLARELAPHVDDCLASARRSTGDVILADCVFGRTHTKLTTVEGLHQHDLMGDMAGF
YESGPRPLLSVHHWKSWYREPVDRMAAVADVCGDCFLQRWRFGADTLLANGYSIARYIDG
LDGIDLSRTEVTWVSPDGSNDNFAWSLGPFRDRVPDGHKKTYKVLDAVRGGGRLRQLYVY
RGNQELGEKDEVVELVWMP

Enzyme Prediction     

No EC number prediction in KLU92371.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	6.17e-12	242	373	209	341	hypothetical protein; Provisional
398362	DUF604	2.64e-09	293	373	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	2.68e-07	245	351	86	204	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ53356.1|GT31	1.11e-182	58	497	80	509
AEO60093.1|GT31	2.20e-145	54	497	76	537
AEO67880.1|GT31	1.24e-132	62	497	54	511
UKZ80054.1|GT31	5.31e-124	16	497	20	501
UKZ93174.1|GT31	7.19e-122	3	497	10	500

PDB Hits     

KLU92371.1 has no PDB hit.

Swiss-Prot Hits     

KLU92371.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000003

TMHMM  Annotations     

Start	End
7	26