CAZyme Information: KLU92148.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU92148.1
• CAZy Family: GT20
• CAZyme Description: endo-1,3(4)-beta-glucanase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919		99561.06	9.1613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876979:346877-349998(-)

Full Sequence      

MLWYIGLILLQAASCSAEPVLNHQGHHRHRHTARDSPPEYTSPDPAGLFSSTAPSPQPVK
TVLPGHITTLSGSTKSSSLDTYLPTSTIPVITRLVEAGIEQIALNPTPGPPLGASGTIIT
TLNTTGQATQPRLLPPVLTTEPTMVFSFLNKSSKQPVNRIAAGPQPESNTPENQSELGSL
SIDSESQYEDAVSELGFSPVMLLTAERVVSTNVFAQPISGGAAPPAFFERRQDHPVPRTG
IASPTPLATNKFYSNLYLGGLRSPVYLHPYALHWVKGQGVTKSWGMSISHVEASQRVFGP
TDPTTGASRFFINPIHIESLILSATDLGATTALTMAQMTAFSAMAELRPNNRALPSVRIP
LVQGSAFITGVYQGSIPVIGTGVHFKTITRALKAPKPGVVKYKIILENGATWLLYARNMG
GVPLDLQIRNSKTAVSTSAFHGTIQIAKDPGNGAAVYDQACGAYATSTELSGTVKGTVGS
YTLTFKKQGLTSSPLLMFALPHMVASFNGATTRGVTPLRLQTTTKGIAAGVLGDSWTVEE
KSLPTDMGFLPWLPGKGTLVISSKAKAAILPIARSEIAQDMSAQSNLDSMYFSGKALAKF
ATILIAVNDMLGDKQLAQAGLKKLKDAYARFAENRQKFPLFYESAWGGVVSSASYVTGNP
GVDFGNTYYNDHHFHYGYFVYTAAVIAKLDKVWGSKNRDFVNTLVRDYANPSAKDKFFPV
YRNFDWYHGHSWAHGLYDTLDGNDQESSSEDAMSAYAIKMWGWAIGDRDMEARGNLQLAT
LARSLRYYYLYTSDNNVQPAQFIGNKVAGILFENKIDHTTFFGNNIEYIQGIHMIPLLPF
APLCRSNRFVDEEWQAYFSKGRIDSIPGGWRGILIGNLAHIDAKRAFGFFSSNGFDASHL
DGGASRTWYMAYSAALGGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	241	912	7.4e-217	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	210	918	51	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	561	910	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.26e-138	234	554	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
282904	Herpes_BLLF1	2.47e-04	36	171	469	593	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62182.1|GH81	0.0	86	916	80	872
AEO64126.1|GH81	0.0	205	919	161	875
AEO58881.1|GH81	1.17e-303	205	919	96	840
UQC73708.1|GH81	4.17e-290	203	917	1298	2012
QSZ30780.1|GH81	1.44e-289	212	918	54	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.69e-80	249	887	43	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.54e-79	249	887	68	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.55e-78	249	887	43	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.25e-27	356	873	122	617	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.93e-24	431	836	209	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.01e-230	225	914	203	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.39e-166	217	918	6	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.47e-156	211	916	45	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	6.70e-155	224	916	411	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	4.78e-148	223	914	436	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000355	0.999617	CS pos: 17-18. Pr: 0.9609

TMHMM  Annotations     

There is no transmembrane helices in KLU92148.1.