CAZyme Information: KLU91959.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU91959.1
• CAZy Family: GT2
• CAZyme Description: Fn3_like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4CSK3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792		84455.42	5.0424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876978:682576-685281(-)

Full Sequence      

MWRSTALALLGSASLSSAQFGIIHTQYGTSPPVYPSPKISGAGGWETALVKARAFVAALT
LEEKAAMVTGTTGPCNGNIAPVPRLNFTGLCIQDGPASIRDGVYASVFPAGLSVAASWDR
DMAHAHGALMGDEFRGKGAHTLLGPVVGSIGRSPYGGRNWEGFSPDSYLAGVMAEQNVKG
IQSAGVQACTKHFIGNEQETQRMGSYVQGNVVFSVSSNIDDRTMHETYLWPFANAIRAGS
ASVMCSYQRLNGSYGCQNSKTLNGLLKTELGFQGYVMSDWYALYTGVPAIEAGLDMNMPG
SFWYDMDGTDSYFGANVTAAVNNGTLSIQRVDDMIERIMTPYFALGQDTSHPPVDSSNLS
AHISRRPLWRYNFTLGPLVDVRANHGEFIRQLGAAGTVLLKNERGVLPLKKPMNIGVFGN
DAADLSQGLISFLGVVGDYDMGTLAIGGGSGTGRFSYVVSPLEAIKAKAKEYGGLVQYIT
NNRAITASGGLAAIAPLPDMVCLVFLKAWANETADRTSLLAQWDSTAVVEAVAAVCSNTI
VVLHGAAPIVMPWRNHPNVTAILAAHMPGQETGNSIVDVLWGHVNPSGRLPYTLAADEGD
YSKNLLNSTELLEATDPDAWQADFTEGQLIDYKEFDARGKAPAYEFGFGLSYTTFELRDV
DVSVAASNPSRLPDPEAPIRPGGNVELWETLATVTATVTNTGDVAGATVPQLYLSLPRDE
AGGEGTPVRSLRGFSKVELAPAESATVEFPLMRRDLSFWDTAAQAWRLPVGAIGVDVGFS
SRDLKLKAEIKI

Enzyme Prediction     

EC	3.2.1.-:5	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	81	299	1e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.61e-59	106	785	118	758	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.40e-50	397	632	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	2.52e-48	100	428	75	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	7.55e-35	2	749	5	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.90e-33	105	340	85	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAB09777.1|GH3|3.2.1.21|3.2.1.-	0.0	1	792	1	793
QBZ58223.1|GH3	0.0	4	792	4	793
QRD06596.1|GH3	0.0	6	792	4	781
QDS71883.1|GH3	0.0	3	792	6	803
UJO22853.1|GH3	2.53e-316	2	785	7	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	7.90e-196	30	791	25	852	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
4IIB_A	2.15e-191	30	790	6	837	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5NBS_A	9.69e-188	30	787	20	853	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJI_A	2.60e-187	30	790	6	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	4.88e-187	30	790	7	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NMR5|BGLG_ASPFN	1.03e-300	26	790	46	810	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q2U325|BGLG_ASPOR	1.03e-300	26	790	46	810	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|Q5B0F4|BGLG_EMENI	1.91e-289	27	785	48	809	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|Q0CUC1|BGLG_ASPTN	1.88e-281	26	785	46	805	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|A1DC16|BGLG_NEOFI	6.13e-280	23	785	43	805	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001203	0.998754	CS pos: 18-19. Pr: 0.9536

TMHMM  Annotations     

There is no transmembrane helices in KLU91959.1.