CAZyme Information: KLU91643.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU91643.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	GL876977|CGC1	91926.07	7.8999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876977:1096915-1099497(-)

Full Sequence      

MLNLPTLVLLAAAAAAPWAQAAATPGRDRSSLNAGWKFSRFTSNPDSLSYNTLKPWILPL
ANDFIVNGAKYPPPTGTPPGRNVQYVQSSFNDAGWQNVDLPHDWAITGPFNAPGISGGMG
RLPTNGVGWYRRNLTAMAADVDGTKSVFLDVDGAMSYAAVWLNGNLVGGWPHGYASWRLD
LTPYLKVGSNILAVRLDNPVDNSRWYPGAGIYRNLWLVKTDKTHVAQWGTFVTTPTVSAS
SAVVNLAVQVENLRNETRQVDVGTEVYKIDPSTGEAGTAVVASFKKSTVSVAAGKKQSVN
ASVTISNPQLWGPAPGQTPNLYLAVTTLSVGGTVIDTYTTRFGIRSVTYDANRGLLINGQ
LVRVQGTCNHHDQGAIGAAINLRATQRQLQMLQEMGSNALRTSHNPPAPEFLDMADSMGF
MVLDEVYDCWSQGKTGNDYHLLYADWHEPDLRSFIRRDRNHPSIVAWSIGNEIQEQGTAL
GGTEGRELVGIVKSEDPTRGVTSAMNSAGDSAPLPAALDLVGLNYQGEYGAYGGFHSKFP
SKMIWGTETASCISSRGTHLFPVTSSNNAGYSTAGGSDGSRMWVSAYELQNPGWGGSPDA
IWDSQDRFPFVAGEFVWTGFDYLGEPTPYGGNGGARSSYFGIVDLAGFKKDRFYIYQARW
RPDLPMAHILPHWTWPDRVGQTTPVHVFSSADEVELFVNGASQGRKKRPGKSVYRFRWDS
VKYSPGDLRAVAYKGGKEWAVDTQVTAGNAAALKVTVDRAAIAADGADLAYITVAVVDAK
GTVVPRANNTITFAVSGPGKLVATDNGDPTDMTAFPSASRKAFSGLALGIVKANAGATGS
ITVTASSGGITGGQVVIKAG

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	780	1.3e-115	0.7300531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.21e-66	24	678	7	618	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	3.20e-45	24	533	7	480	beta-D-glucuronidase; Provisional
408349	Glyco_hydro2_C5	1.76e-42	753	856	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236673	ebgA	1.73e-35	88	501	66	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
406696	DUF4982	2.39e-27	680	742	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO71826.1|GH2	0.0	6	857	7	861
AEO59435.1|GH2	0.0	26	859	43	880
QRD01710.1|GH2	0.0	17	859	22	875
QRD03755.1|GH2	0.0	24	859	39	880
CAE7211356.1|GH2	0.0	23	858	62	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	3.34e-192	89	850	48	811	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	8.82e-181	89	857	27	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.81e-174	90	851	34	799	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	9.70e-149	82	857	23	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	2.06e-148	82	857	46	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	2.08e-178	80	858	56	845	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	6.00e-108	85	814	65	775	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	7.83e-54	89	798	49	737	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	3.33e-51	81	708	65	677	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	9.07e-42	127	802	57	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999769	CS pos: 21-22. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in KLU91643.1.