CAZyme Information: KLU91347.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU91347.1
• CAZy Family: GT1
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		44055.24	4.7901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876977:149967-151142(-)

Full Sequence      

MIHFHPDLRIVDDPMREENYIQSSTDQVHASNLLVLDSGEVLCAWFGGSMEGVSDIYIWL
AWLAPGAEDWSEPIQVSDDPARSEQNPVLFEDPRTKNLWLFYTAQEHGAQNKCLVRRRVS
TDRGRTWSEAQEAFPDRGVFVRQPIMVLPDKEGPGRDVWVLPVFYCRAEEGVEWVGNDDI
SAVKYSADGGETWRESVVPDSRGAVHMNIRPDPSTEGDGWVAVFRSRWADNIYISRSQDC
ITWSKPEPTELPNPNSGIGMAVTKSGRLVLVYNDSRATPNMTRREGLYDDIETGGPKLKK
QAVIDGKPAIWGTPRSQLALATSDDGGRTWKTQGVLEDGDGFCLTNNSKNQRNRELSYPS
IAVGADGTIHVAYTFWRMRIKYCRIKEEDLQ

Enzyme Prediction     

No EC number prediction in KLU91347.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	29	373	1.3e-18	0.8859649122807017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404074	BNR_2	1.69e-60	39	371	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
227036	COG4692	1.58e-56	27	385	32	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
271234	Sialidase_non-viral	1.16e-41	22	385	8	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63439.1|GH33	7.01e-214	2	391	5	395
QMW26624.1|GH33	4.15e-134	18	388	24	383
QRD87235.1|GH33	4.15e-134	18	388	24	383
QMW38703.1|GH33	4.15e-134	18	388	24	383
BCS13746.1|GH33	1.11e-133	8	388	11	381

PDB Hits     

KLU91347.1 has no PDB hit.

Swiss-Prot Hits     

KLU91347.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000048

TMHMM  Annotations     

There is no transmembrane helices in KLU91347.1.