CAZyme Information: KLU90999.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU90999.1
• CAZy Family: GH79
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1035		104412.57	4.2599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876976:526013-529265(-)

Full Sequence      

MMPLGHLLLRLVVGLAALPSLAQAAEAACYCPRPEGLSQRHYGVDFRTPPSADLTDYWHA
SSGSNITRDGDRGAGLQYVNRHDAPQIETDFHIWYGRVDFDLQAAPGRGVITSAALKPNE
GEGVHWGWSGNDFGQDQGLVQTNVPARGGVTGNNDRRIWEAVDNPQGSVHTYSIDWTPEK
IDWLIDGNLVNTRLAADADRDGEPFPQTPSRVQFGVWAGGDPSNGPGVVDWAGGQTDTQD
GPYAAYLRKVSITNYNPAGTYEYAENPDGTMSVRPINSPSRGGPGDAQSLGTNNPSRQPL
LVGLPRSERGTCGAGAGKSCQGSPFGECCSRYGYCGNSAEFCGSGCQSAYGLCSTPSLFN
QANKPELDRNPVTRIASVSSSPQSTAAPSLLPSGRRGDRQTAFGPGEISTRRVSLPNAAP
SSPATSTQRTAGPHRPVRLPFSRGDQGAVPLPIIPTPSSGSNAVPTDLDGALPLAAPTST
SSHRPGRFPFSSRTGTRTVLRPQRASDASSTRGSTRRSPMRVSRTRDSTFSRPPRTSGSS
RTRSGAFSRPTGASDSGVTTRNRAASTTTTTTPESTPAPNGPVLGTGSSSPASTEAPIPA
PPEDSLPAPPENSLPISQEDSLPEAPENPLPAPPENSIPAPSEASPVPIVSGDGDPRPGP
LGGARPAAGGLDSNNAVGGSSSAMAGSNNGIASPTVVSASSSTASDASVPDVTTSGSGDP
MITTAAGEAAASSGDATFVSSGGAATTGPNDAIVTVPEGPTTTTSGDNTFANAEGATSLG
SEDATATASGGAITASSGDAAVTASEVVTVTTFEEAATTAPGRVTTTASEEASTISSGDA
AVSTSESGAAATPSGATTTSSESATVASFEHGATTGPEDATAANSESFTTTSAPIDAAIA
PPERVVATTASDSTTVAGFDGAATTTRPGDATVATPVEPAATSASDSATNIQEATTTDSE
DAAVTAPEESTTTSTPEDTQSLPTVATPDSEQATTTSSDDATISPIASESATVTDSDDAM
GATSASTEATTTSSE

Enzyme Prediction     

No EC number prediction in KLU90999.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	73	234	1.2e-42	0.9810126582278481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.38e-60	56	256	10	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	5.69e-35	81	233	19	168	Glycosyl hydrolases family 16.
211316	ChtBD1_1	1.11e-18	311	353	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	1.39e-14	311	348	1	36	Chitin recognition protein.
185684	GH16_lichenase	9.49e-14	95	253	68	211	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64343.1|CBM18|GH16_18	8.38e-88	4	375	7	376
BAI44127.1|CBM18|GH16_18	8.51e-88	31	375	38	376
BCR86764.1|GH16_18	5.50e-52	16	280	12	270
CAA11266.1|GH16_18|2.4.1.-	1.86e-50	31	274	42	274
QIW98190.1|GH16_18	5.86e-50	9	274	5	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	1.21e-52	31	274	11	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1GBG_A	1.26e-11	80	233	57	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3D6E_A	4.52e-11	80	233	44	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
3O5S_A	3.73e-10	80	233	81	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
5DZE_A	2.10e-08	59	260	27	204	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0P4|CRF1_ASPFU	3.83e-50	31	274	32	264	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|D4B4J2|CRH12_ARTBC	9.78e-38	31	280	39	276	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|D4ALQ5|CRH11_ARTBC	1.37e-35	9	265	1	248	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|P53301|CRH1_YEAST	2.79e-34	34	273	50	275	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	4.66e-32	70	274	66	261	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999785	CS pos: 24-25. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in KLU90999.1.