CAZyme Information: KLU90839.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU90839.1
• CAZy Family: GH76
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4E9R7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		24231.59	8.7259

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876976:73029-73808(+)

Full Sequence      

MQIFSLATLALGLLATTASAQSKVKVMLLGDSITESTCWRGKVWSQLASAGLTSSVEFVG
TQTGVPFGCGTMPSGFDRRHEGHSGFQAYDIARNNIAGWVGTTKPDVLQFMLGTNDVNIG
KRSAQSILDSYTAILNAARAANPKVNVIVDKIIPTRWSDATIEAVNAAIPSWASQHSTAA
SPITVADCSRAAGYTNAMLVGDGVHPNGQGDIFIANQIGPKLIAAIKAVRGG

Enzyme Prediction     

EC	3.1.1.6:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	24	216	4.4e-51	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.57e-46	24	216	1	151	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	5.00e-15	28	210	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238866	sialate_O-acetylesterase_like2	3.24e-10	103	210	47	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	4.94e-09	25	218	3	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	3.38e-08	26	221	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB73025.1|CBM1|CE3	5.45e-106	4	232	3	228
CAP67628.1|CBM1|CE3	5.45e-106	4	232	3	228
CDP23889.1|CBM1|CE3	5.45e-106	4	232	3	228
UMZ45356.1|CBM1|CE3	8.01e-103	9	232	6	226
AEO70878.1|CE3	6.08e-102	27	230	14	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	3.24e-99	24	229	2	206	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	9.25e-99	24	229	2	206	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
2VPT_A	1.00e-12	20	231	2	204	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

KLU90839.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999743	CS pos: 20-21. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in KLU90839.1.