CAZyme Information: KLU89708.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU89708.1
• CAZy Family: GH45
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4E7Z4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		44303.70	7.0832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876973:999054-1000755(-)

Full Sequence      

MFSKMQLFASALLASEAAALVVAHHRHGHHGHRPYKRELVYEHTDVVVETVWVTKTVYDG
EPDPATTATSPSVFKAVPATKSTTSSSTTSAPAPPPPPPPPPPASTSTPAAAAPPADSQP
APADKPADKPADKPADKPADKPADKPADKPADKPADKPADKPNNNNNNSGGSASAPAPGG
NKRGMSYNDASLTAPFLGAGNKVSWAYNWGQRPDGLNAAGVDYVPMLWGPIDMHTSTWKK
NAEDALNKGAKALLSFNECDFPSQCNKSPAEAAAAHIQWMNPYAQRAAVSAPAITNSNIK
GQGLDWLRDWVRACNGQCEFAFCAAHWYSPPDPADLLGHLDKVHEICGGKPVWLTEFAPI
SGDKVKFLKDVMKELDTNPKYSYVQRYAYFMVGVGEDKLLSAPATMNAVGQAFGYQ

Enzyme Prediction     

No EC number prediction in KLU89708.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	199	412	3.9e-58	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	8.82e-59	186	413	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
237081	PRK12372	6.42e-06	124	162	324	370	ribonuclease III; Reviewed
237081	PRK12372	4.28e-04	125	180	339	398	ribonuclease III; Reviewed
237081	PRK12372	4.97e-04	127	195	311	382	ribonuclease III; Reviewed
411407	PspC_subgroup_1	0.002	124	161	410	450	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60320.1|GH128	2.28e-125	1	415	1	430
UQC74149.1|GH128	5.62e-75	182	413	151	385
UNI19332.1|GH128	6.33e-66	182	413	156	384
UNI20131.1|GH128	2.68e-65	182	413	88	314
QUC23818.1|GH128	2.68e-65	182	413	132	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAY_A	3.57e-47	175	413	28	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB0_A	2.22e-46	179	413	1	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAX_A	2.64e-22	178	413	91	342	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UB2_A	1.83e-17	182	410	25	250	Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_C Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_D Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB3_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB3_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB4_A Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB4_B Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB5_A Crystal structure (P21 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB6_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritetraose [Lentinula edodes]
6UBC_A	5.04e-09	172	389	193	411	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]

Swiss-Prot Hits     

KLU89708.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008474	0.991478	CS pos: 19-20. Pr: 0.8615

TMHMM  Annotations     

There is no transmembrane helices in KLU89708.1.