CAZyme Information: KLU89345.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU89345.1
• CAZy Family: GH43
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4E717]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		44126.43	5.5965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876972:1940601-1941827(+)

Full Sequence      

MGLQRGSSLLALVLLLASIYGAAADKHIVNDTECGCFMTNASNPTFFSKHRFYDFRSLTQ
HVVDPPALLNDPAAAAAAPATSSFFNTKPFADDWAIMSWNNSASVGNQATYLFVHSPSNI
YIERNSDPGASSSDTYLTMRTARLGGFQSTAELQSMAANYRFVSVRMLARTLGDPGACTA
LFTYRGDEHVERVQEADIEILTKDPKTYIQYTNQPSFTSDGNSVEGASLNVTAPVPWTEW
AVHRLDWSPNQSTWFVNGVQVAALGYQVPRDGSHVALNAWSNGGVWTGSMEVGKQAHMQI
KWLEMVFNSTSDYETGNSYSKLVRDTGTTTSLTGAAVKGLSSDGKRCKTVCSIDESDERG
LAVVLSSSGSSPFRKTALQSGDGVESTVWIPLLMTLLAIASSLPFVVV

Enzyme Prediction     

No EC number prediction in KLU89345.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	92	305	2.9e-91	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.19e-55	84	306	3	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	6.34e-06	164	303	72	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	3.14e-04	160	322	116	268	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
395585	Glyco_hydro_16	0.002	137	302	15	166	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55690.1|GH16_22	3.03e-132	11	403	12	402
QKD50890.1|GH16_22	7.95e-104	12	371	12	361
CCT66306.1|GH16_22	1.53e-103	14	371	1	348
QPC74272.1|GH16_22	1.40e-102	30	371	25	364
CEF84700.1|GH16_22	1.49e-101	30	371	25	364

PDB Hits     

KLU89345.1 has no PDB hit.

Swiss-Prot Hits     

KLU89345.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999804	CS pos: 24-25. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in KLU89345.1.