CAZyme Information: KLU89092.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU89092.1
• CAZy Family: GH43
• CAZyme Description: alpha-L-rhamnosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732		79154.45	5.6594

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876972:1163909-1166418(+)

Full Sequence      

MLPRLLLAAVAVPTCLAMATPVRSPDLGPRADAPSWHQYVRASGSRSILPRAIVASRQAG
NVSSPDGFMTGKAPTVLSRLSPSEEKPSIVVDFGQNTVGILSIQFGGSSTVNGNGRALPG
LKLAFSETLQFLTNRSDFTRSDHGDGDSKLTQGTDQIAVRPEPYEWTNQLGCQNGRQVCS
DGLHGFRYVRIWLDAVDSDAPFTTSFGTVSIVSMKLELSAFHGTPDTFRGNFECSDAAIT
QWWYDAVYTNDLCIDTFRLNDTEPRNGGSPTLAGKLVLHDGPKRDRDPYVGDLAVAALTA
YLSHDVAESSSNVLEDLARHQRSDGWIPPASIGNYGLQLFDYPLWWVVCSCDYVLYTGNG
TFLQDLWPNLVRVLDGFYPGVTNAATGLIERKDYGDYAFIPREGAVTYYNALYVRALNYA
ADMAEQLGHGSDAPRWRSRATLVGDALLRRNWDRSVGAFFDGGRCGSQQLCLTHPQDGNS
LAILTGIANTTTPVTGRNGSVAESILSYLDSAHRRPYGNAFFDNDAYQSGYSQRVYAFIS
YFEIDARFKVPSAVDSAFDEIRRLYGAMSSGDPGVTFWEGIGPGAKPYQDGFTSMSHGWS
TGIVPVTINRVLGIMPTKPGFAEWEVKPVVGGGLTWARGAAPTPKGEFTVSWSTTVEGGA
DAEFRIQISSPRDTKGTVSVPVSGAGVTVELNGGNIYNVGADGAREGVAYKDGRVSFAVD
GGKHDIVVFRRA

Enzyme Prediction     

No EC number prediction in KLU89092.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	86	679	4.9e-85	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.12e-18	230	537	4	287	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	9.72e-12	613	694	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
283786	GDE_C	4.02e-10	341	461	84	220	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
225942	GDB1	2.02e-08	312	530	307	534	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
407295	Glyco_hydro_36	2.93e-06	332	518	117	308	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59627.1|GH78	0.0	2	732	8	733
UKZ97108.1|GH78	2.66e-279	14	728	11	710
UKZ64081.1|GH78	3.53e-277	26	728	20	710
QYT03284.1|GH78	2.98e-271	35	728	29	711
UKZ78837.1|GH78	2.17e-264	36	728	32	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.18e-19	225	650	297	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.81e-06	277	464	234	425	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

KLU89092.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000424	0.999540	CS pos: 19-20. Pr: 0.8202

TMHMM  Annotations     

There is no transmembrane helices in KLU89092.1.