CAZyme Information: KLU88756.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU88756.1
• CAZy Family: GH37
• CAZyme Description: mannan endo-1,6-alpha-mannosidase DCW1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	GL876972|CGC7	38472.13	7.1807

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876972:41692-42820(-)

Full Sequence      

MRLLRRAAAAACLLTQLPVANAAIQVDIKDPNSVRAAASTVAFGLMKYYTGNNTGDVPGN
LPAPYYWWEAGAMFGTMIDYQSLTGDKTYSDVTTQAMLHQAGELRDFMPKNQTKTEGNDD
QGFWAMAAMSAAENRFPDPPPDKAQWLALAQAVFNQYVTRWDTATCGGGLRWQIFTFNNG
YNYKNSISNGCFFNLAARLARFTGNQTYAEWAERVWDWTERVQLISPQFDIYDGASVEGG
ANCTKHDMVQWSYNAGIFLHGSAFMYNLTGSDKWRQRVDGIVNRNSEIFFNGTAMFEPAC
EGVKLCNNDQRSFKGYLTRWMAGTASWPHSRPSAFRCSCAATPSS

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	327	2.2e-98	0.770949720670391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	8.05e-162	33	325	1	292	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	6.99e-05	65	259	44	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC82430.1|GH76	2.26e-178	1	325	1	323
QBZ64721.1|GH76	2.96e-174	1	325	1	324
QLI65312.1|GH76	2.38e-161	7	325	7	323
AEO63329.1|GH76	5.75e-156	1	330	1	330
UPK93215.1|GH76	2.80e-154	1	333	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	4.02e-105	25	331	29	342	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	4.80e-117	24	325	19	319	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	5.51e-115	23	325	19	319	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	6.86e-115	23	325	21	322	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.23e-110	10	336	8	336	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.61e-97	23	325	18	323	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999654	CS pos: 22-23. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in KLU88756.1.