CAZyme Information: KLU88262.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU88262.1
• CAZy Family: GH31
• CAZyme Description: periplasmic beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		84811.00	6.4122

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876971:1059451-1061877(-)

Full Sequence      

MRLPSEAAVVALSLAVALPASAFSRRDSRNDTTSAIYRNPNATINDRVADLLRRMTIEEK
TAQLLQGDIRSYLNLTDASFNSSGLLWTAEKRANSIWTGLYTTPETVSLGARLAQEHLVR
NTSLGIPAFIQSEGIHGLLALNATIFNSPIAHGCSWNPALVGKMARAIALESRAIGVNQI
FAPVVDLARELRFGRVEECYSEDAFLAGEYGHAYVKAMQKEKVSAMVKHFAAFATPEQGL
NTAPVHGGPRMLRTTYLPAFKRAILDADAWGVMSSYNSYDGVPTVADKGLLTGILRDEWG
FENYVISDAGGTARLADAFHVCARADDVCITQKSITAGNDVEMGGGRWSFELIPKLVANG
TLPVEVVDKAVSRVLRAKFKAGLFENPYTAVPDNEIAQHLNTTEHRKLARDLDAESIVLL
ENRKGLLPLRKSSRVAVVGPMAHGYVNYGDYVIHTAMKRGVTPFDGIRAAVDAGGGSATF
AQGCERWSNDEAGFGAAVAAARGADVAVVVVGTWSRDQDELWQNLNATTGEHIDVHDFSL
VGAMPRLVKAVIDSGTPTVVVYSSGKPVTEPWISNEAGALVQMFYQGQEGGHALADVLFG
DVNPSGKLSVAIPYHVGTTPVYYDYLNSGRASPSPGRELPNGTLVFGQNYVLSSPLPHYE
FGYGLSYSNFTYSDLAVSSSTLSPTDTLTVTVKITNRSSRDGKEVVQVYVKDLLSSVAVP
NKQLRGFWKGMVRAGQTETVSIDLPVDKWGLWDYEMKYVVEPGQFQILVGASSADIRVNT
TVTVG

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	120	343	1.7e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	8.05e-144	1	777	2	758	beta-glucosidase BglX.
224389	BglX	7.32e-80	55	443	1	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.01e-60	124	742	79	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.40e-56	56	377	1	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.24e-42	417	667	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56188.1|GH3	0.0	1	784	1	780
UQC73622.1|GH3	0.0	12	784	5	774
QPC69863.1|GH3	0.0	36	784	24	769
CEI60795.1|GH3	0.0	36	784	24	769
UPK91229.1|GH3	0.0	36	784	24	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.67e-303	37	781	7	753	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.79e-302	37	781	7	753	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	3.57e-117	7	777	10	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	3.01e-111	46	777	10	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	1.52e-109	46	777	11	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	3.23e-109	48	777	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	3.84e-105	73	784	7	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	5.45e-105	48	777	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	2.04e-99	29	777	21	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	9.42e-83	102	784	13	674	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000455	0.999514	CS pos: 22-23. Pr: 0.9709

TMHMM  Annotations     

There is no transmembrane helices in KLU88262.1.