CAZyme Information: KLU87002.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU87002.1
• CAZy Family: GH18
• CAZyme Description: hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670		74698.60	5.5571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876970:419475-421893(-)

Full Sequence      

MHLLQHALLLLHGVAPLGTVAQLADRQFNPFPSLPFPFPRPPSRTSTPTSTPTPTPYAVQ
KPPLDTDWTYKVGTNPWPEYPRPQLVRHNGWKSLNGLWTWRAASGTGELAAPPSGLLDRE
VLVPSCIESGLSGLQELDVQYMWYATNFRVPGGWEGRGKTLLNFEAVDYETRVFINGVEV
AHNIGGYFRFTVDVTEYVSYDRNNLLTLFVHDPTNREGFLVPTGKQVINPSHIFYRSCSG
VWQSVWLEHASNDYITALDVAADMDGKVNITVHSAGRANASVSVSVTEAGGAEVASHSGV
ADKPFTFNVASPRLWWPDTPNLYNITVKLGNDSVTSYTGFRTVSRGVVQGVQRPLINREF
LFHFGTLDQGFWPDGLHTPPSYEAMVFDLKLLKRLGFNMVRKHIKIEPDLFYRACDEIGL
MVYQDMPSFPVDRPQATEEQQAQFERQLALMITEHRSYPSIVTWIIYNEGWGQINNPPAE
GPLTDMVRSLDPTRLVNSVTGWTDHGFGDYSDNHKYASPQCGTPFYSRPSPPHDPSRIGF
QGEFGGVGLNTTIEHLWDVKQAIDQIDQTYEINKDKASYNYRSHQLLTELRDQTERFECS
GAVWTQTTDVEGEVNGLITYDRREMHAEEEQWRADIQALYAAAAGRGGKVGGGTGAGADD
GGAGSLIRQP

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	89	520	1.3e-96	0.5053191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	6.47e-45	92	501	13	434	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.01e-35	82	500	3	449	beta-D-glucuronidase; Provisional
395572	Glyco_hydro_2	1.63e-15	253	341	5	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236548	lacZ	8.03e-10	239	496	207	485	beta-galactosidase.
397120	Glyco_hydro_2_N	2.88e-07	143	205	68	129	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61779.1|GH2	3.85e-288	57	654	40	642
UKZ84644.1|GH2	1.47e-287	57	646	28	615
QLI73958.1|GH2	9.55e-286	57	648	31	622
QYS93190.1|GH2	2.06e-282	57	646	26	614
UNI13367.1|GH2	5.55e-282	57	648	34	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.35e-102	64	631	12	574	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	8.37e-27	82	496	11	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	2.20e-26	82	496	36	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6ECA_A	1.50e-24	92	500	41	471	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
3GM8_A	8.00e-22	143	515	69	438	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	2.26e-20	91	494	79	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	6.18e-20	135	499	50	415	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KM09|PLH16_FORAG	1.71e-18	160	501	125	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|A0KQH4|BGAL_AERHH	1.71e-18	144	504	126	493	Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lacZ PE=3 SV=1
sp|P05804|BGLR_ECOLI	2.34e-18	92	499	13	444	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000313	0.999667	CS pos: 21-22. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in KLU87002.1.