CAZyme Information: KLU86954.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU86954.1
• CAZy Family: GH18
• CAZyme Description: secreted glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	GL876970|CGC12	34346.01	9.6650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876970:278626-279609(-)

Full Sequence      

MSAFKTFLVSSLAIGAGLCNPVPAGRAQNHPTAAEAEAAVPATGGSIKPPAGFTKVVFLD
DFSKAKAGSQPSKAKWTYDLGIGYPGGATNWGTGEIQHYTADKENIAIVDGALRITPVKK
GEKWTSARIETTASQDFTCPPGKKLRIEASIKIPASDPSTQMGIWPAFWSMGSAFRNNVT
SWPAIGELDVLEVSNGSPQVFHTAHCGVVNGGPCEEKNGKGSGATYTRGKWTKFAIDVDR
TSKDWKAEKLVWSVDGKPTFTLTGQQVGDAKAWAPLTSTPKMILLNVAVGGEFPNAKAGK
GVVTPNAKTVGGPQSAMDVKYVAAFTS

Enzyme Prediction     

No EC number prediction in KLU86954.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	60	324	2.4e-50	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	1.72e-109	52	326	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	8.90e-46	58	322	1	232	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	8.39e-16	60	325	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185694	GH16_CCF	2.76e-10	56	322	1	326	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
185689	GH16_fungal_KRE6_glucanase	7.00e-10	91	293	30	272	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC90783.1|GH16_3	6.63e-126	43	327	81	365
QBZ55217.1|GH16_3	8.46e-120	42	327	191	476
QUC20157.1|GH16_3	2.26e-87	52	326	40	316
QBZ61307.1|GH16_3	2.69e-86	47	325	102	385
AAX07660.1|GH16_3	3.80e-86	47	325	102	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	2.89e-63	44	327	1	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	2.31e-58	49	299	5	254	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	3.93e-30	56	294	5	217	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	1.24e-25	56	294	9	221	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
6JH5_A	4.17e-16	56	294	6	210	Structure of Marine bacterial laminarinase [Aquimarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	1.25e-18	56	325	425	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|P45798|GUB_RHOMR	5.33e-15	55	293	41	259	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000759	0.999211	CS pos: 18-19. Pr: 0.3210

TMHMM  Annotations     

There is no transmembrane helices in KLU86954.1.