CAZyme Information: KLU86661.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU86661.1
• CAZy Family: GH16
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0C4E008]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796		86839.42	5.4036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876969:2764877-2767796(-)

Full Sequence      

MRCTGSCCTAPQDSKMAQIDVEDVLKKLTLDEKVELLSGIDFWHTRPVHRLGVPSLRLSD
GPNGVRGTKFFNGVKAACFPCGTAMGATFNLPLLEEAGKTMGADAKTKSAHVILGPTINI
QRSPLGGRGFESLSEDPVVAGLGAAALIRGIQSTGVQATVKHFVCNDQEHRRNACQSILT
DRALREIYALAFQLAIRDGHPAAIMTGYNGVNGTYCSENNELLEKMLRGEWGWDGLVMSD
WFGTYSTTDATLAGLDLEMPGPPKFRGDLLKFNAITDKVRGHILDERVRAVLKLVNKCAA
AGVEENGPETTDLDTPETAAFLRRIGNESLVLLKNDNDVLPLKKDKKTVVIGPNAKVATY
HGGGSASLAAFYAVTPFDGIKEKLESAPGYAIGSYSHKMLPVLGLSTVTDKGEPGMTMRV
YNEPPTASHREMTDEYTFVKTDFLFVDYYNKKLRSNVWYADFDGFMIAEADEEWEFGLVV
QGTGNLYINGELVVDNTTHQRPGNAFFGSGTEEEKGRYKFCKGEKYHIKVVFGSGPTSKL
STGSVIIGHGGMRVGGCRVIDAAEEIRRAAELAKDADQVIVCAGLNADWETEGMDRPGMD
LPPPLDQLISAVAAANPRTVVVMQSGTPVHMPWINDVASVVQAWYGGNETGNVIADVLFG
DANPSGKLPLSFPVRCRDNPAFLNYRSEGARVLYGEDVYVGYRYYEFADRDAAKVNRPLK
ELKGFAKVDLAPGETRRVTVELDARYAASYWDEDRGKWCAEKGDYEVIVSDSSVAVEGKT
LRGSFTIPETFWWSGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	48	260	1.8e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.55e-63	50	357	57	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.65e-57	330	702	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	4.72e-47	21	787	38	764	beta-glucosidase BglX.
178629	PLN03080	4.47e-31	28	707	60	627	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.03e-28	50	294	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ56956.1|GH3	0.0	16	796	10	844
UQC84651.1|GH3	0.0	16	796	1	833
UKZ86562.1|GH3	0.0	16	796	1	836
UKZ50443.1|GH3	0.0	16	796	1	835
QYS95379.1|GH3	0.0	16	796	1	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.19e-247	16	796	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.70e-241	17	796	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.36e-114	19	773	3	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.63e-96	28	783	12	665	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.46e-82	23	787	56	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	7.01e-293	16	796	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	8.32e-292	16	796	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.31e-290	16	796	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.85e-290	16	796	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	5.46e-290	16	796	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KLU86661.1.