CAZyme Information: KLU86098.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU86098.1
• CAZy Family: GH146
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4DYJ5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		26725.34	6.6053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876969:1004767-1005612(+)

Full Sequence      

MLGEWQKLLPVVLAVLAAGRAGAQKAEFPLRAMPIGASITAGFSAGKLTDGYREPLLEKL
VADGWQLHYVGTQRSGNSTENHHEGYPGIRTAALASQTRANGVVDQFKPNLLLLNVGTND
CTARVTRAEARRIHSDMIDAIFAPAYATDPNTAPLLITSTLLPRRGNDAAVQQCTLYFNE
EIRDLARTHPRSASIALADMNNGTFITVDDLAPGDALHPSAEGFAKMATVWYEALNANLD
KLHAPVQL

Enzyme Prediction     

No EC number prediction in KLU86098.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	30	235	2e-42	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.34e-26	30	235	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	5.54e-15	35	234	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.51e-12	35	226	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	6.28e-06	33	228	2	221	GDSL-like Lipase/Acylhydrolase.
238858	PAF_acetylesterase_like	0.001	101	235	82	210	PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues. In addition, PAF and PAF-AH are associated with neural migration and mammalian reproduction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58482.1|CE3	1.87e-88	4	245	4	242
CDP24531.1|CE3	1.57e-26	27	245	46	250
CAP67115.1|CE3	1.57e-26	27	245	46	250
QRD87153.1|CE0	1.22e-25	27	241	44	258
UCK59306.1|CE0	1.22e-25	27	241	44	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	2.20e-08	30	248	6	208	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

KLU86098.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.436350	0.563629	CS pos: 23-24. Pr: 0.5231

TMHMM  Annotations     

There is no transmembrane helices in KLU86098.1.