CAZyme Information: KLU85839.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU85839.1
• CAZy Family: GH131
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		86381.60	5.1441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876969:130192-132691(-)

Full Sequence      

MPPVRLWLGSVALAAITGAVIGSPAHNIRCHKRQAAPLIKGQDGQITLTSTGTEPGIVVL
DYGVETEGIPSFEVVSASGDTSALDITYSETKAALSLYMADGPLPLAAAMDTYRVNRYSI
SGPGQFTNRLIQGGFRYQKLNLSSPGALTLQNVGVRPTVATHALNELPGSFASSDSAITD
IWTAGAKTVQLSEIPKGSVPEFWEVSDEGAVIESLAPQANQDVIAVTSTAYGLDFKVKPV
VGGFGFSVLSDTLNSAIYMSVDVAARTIVAYVGATTLDAELTRATIPRNVTLALGSWHTV
HADVSLAGISVKINNQSVISFTQTQKFFGSYGLGASFGHKAIFRDIVAKDPAGAVTYEHP
LTNKSFMEDFVLATNPLSASVDGSRRDRIAYAGDLDVAGAAALASTHGLEFIQGSLDLLG
SFQLPPGFFTPTVKIQQPPLGTPLNVSQTGLIGYSWNLLTAVAQTYMHTGDVAFAQQWAP
KVVKMLDWSHSQLLPNGLFNISDPSIGGDWNYYDPVQGGVVTKFNVLYAYSLQETATLLT
DAGVDVSVYQDRLAKLRSAIDTQLWSDELGAYVYSENIRDGFGQDSNAIAILAGVNLDPA
HSSQTILSNMATLDTPRGPLAFSPGVISRGFQKYISPYASAYHLRAALTAQNSEVAKSLL
DSVWAPMADKQNANFTGTFWETMDEAGRPAFGPQTSLCHGWAAGPTAELSRFVLGAKPTK
PGWAEWAVAPQTIGLKSARGKVPTTRGDVVVSWNFSGDLLTMSVEGPAGTSGNLTLPTPL
PIASADSVFTLDGTPVEGTSFPVLGGKEVVLVQSRK

Enzyme Prediction     

No EC number prediction in KLU85839.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	375	776	7.5e-66	0.7361111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	4.61e-12	715	778	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	3.13e-07	375	705	27	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO55772.1|GH78	0.0	10	816	6	810
UKZ58110.1|GH78	1.21e-314	25	813	25	808
UKZ83809.1|GH78	4.46e-314	36	813	4	776
UQC81548.1|GH78	3.99e-310	38	813	47	820
QPC60789.1|GH78	7.86e-291	34	816	19	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.41e-17	443	776	374	694	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	5.64e-06	374	777	488	899	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

KLU85839.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003460	0.996508	CS pos: 22-23. Pr: 0.9671

TMHMM  Annotations     

There is no transmembrane helices in KLU85839.1.