CAZyme Information: KLU85737.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU85737.1
• CAZy Family: GH128
• CAZyme Description: acetyl-CoA carboxylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
983		106168.52	6.6939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876968:3856927-3860564(+)

Full Sequence      

MAARPGPRRLLQAVALGLMAIAGTASASAVNLPTDPGPGGTAPVRPFRLDQIRLGDGLLQ
EKRDRIKDFLRDYDERRFLVLFNNQAGRPNTDGITVPGGWEDGGLLSGHWAGHYMTALSQ
AYADQGEQVFKTKLDWMVQELAACQKAITARMGSGSDGQQPGNNATVGRVAGKFGNALQL
NHGDQGQQYVTLPQETINQLRDFTVATWVKLAANQTWTRLFDFGRDTTVNMFLTPRADQP
GFAPRFAITTGGSGEEQQINGNTALPVNEWVHIAVTLKGNTGVMYVNGQVAGTNMGMALN
PTSLGNPGNRWIGRSQYSGDAPLSATIDEFHIFSRALSAAEVRSLLASAAGTTGGGNIAW
YRFDEDRGSTLLDSSANGRDAGIVSGRGGSGPSAWVPTHPGYMGALPEDTVLRLGPPRWA
VYGGDAATNTWAPWYTQHKIMRGLLDAYYNTNNSQALDVVVKMANWAHLALTVGDKNQPG
YTGNLTRNDLNRMWDLYIAGEFGGANEVFPEIYELTGDARHLETAKAFDNRASLFDAAVQ
DRDILVLTRDKNPGPRRTDRLHANTHVPQFIGYLRIFEHSGEQDYLDAARNFYGWVFPYR
QFASGGTGGNYPGSNNNAEMFQNRGNVANAMADNGAETCTTYNMLKLARNLFMHEHNATY
MDGYERGLFNMIAGSRADTAATTGDPQLTYFQPLTPGASRDYGNTGTCCGGSGLESHTKY
QETVYLRSADGSALWVNLYVPSTLTWADKGFSLKQETAFPRGDKTKLTVVAAGRDPLDIK
LRVPAWAQSGSVKATVNGETDAQAQNPVPGTYLTLSRAWRAGDTIEMHMPFRVRVERAPD
RSDTQALMWGPVVLQLIGRPPTGSGGNSGYWELSLYRHLKLDGDYARAAVVPRGSSRGDT
LFNVAVAAATGGGQNQTGISSPGTDGPTFLDVLWDRAPFGGHAAFVAAVREVAAQFVAAG
VYTAKERDAIVTKAGEAEAELAV

Enzyme Prediction     

No EC number prediction in KLU85737.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	399	854	1.7e-143	0.8031809145129225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	1.78e-99	415	854	102	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	5.06e-64	434	948	130	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
404293	Laminin_G_3	1.10e-29	184	343	1	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
400342	Glyco_hydro_127	5.82e-07	51	146	1	95	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
214722	LamGL	0.001	201	340	1	133	LamG-like jellyroll fold domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ61184.1|GH146	0.0	31	982	55	1054
BCB86917.1|GH146	0.0	8	982	12	1021
SBT46463.1|GH146	0.0	8	982	12	1031
QOC92017.1|GH146	0.0	8	981	12	1029
AEB44835.1|GH146	0.0	8	981	12	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.26e-65	423	854	152	559	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.96e-62	423	854	152	559	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QVS_A	1.61e-20	168	349	39	223	Chain A, S-layer domain-containing protein [Acetivibrio thermocellus ATCC 27405]
6EX6_A	3.79e-17	415	853	128	543	The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KLU85737.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000544	0.999422	CS pos: 29-30. Pr: 0.5476

TMHMM  Annotations     

There is no transmembrane helices in KLU85737.1.