CAZyme Information: KLU85693.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU85693.1
• CAZy Family: GH128
• CAZyme Description: endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		52943.64	6.4965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876968:3712862-3714649(+)

Full Sequence      

MARLTVLATILLTAASSALGQAGGNGGNRGDGPNRGGGGGGNGGGGGNGGGGGGAATGEG
LHDLAVKAGKIYFGTATDSNNFNDAKYTSIVKDTREFGLFVPENSQKWQSIQPQAGQFNF
QSADQVAGLANSTGGLLRCHTLVWHSQLPSFVSNGQFTKESLTTVMETHISRVMGHFKGQ
CYAWDVVNEAINEDGSFRNSVFFKTLGKDFIPLSFKIAAAADPSAKLYYNDFNIEFGGKK
ADTALSIVKLVKDAGQRIDGVGFQGHFTVGQTPSRQDLASHLKRFTDLGVEVSYTELDIR
HAKVPASAAARQQQATDYTNVVGACLDTAKCVGVVAWQFTDKFSWIPQTFSGAGEACLLD
QNYQKTPAYTAVANLLRSASAGGGAGRGVGGGTNGSNGSGGNGGNGNGNGNGNGGARGGS
RGGGNRATDTFNLESSDEESSPAAISPPAPVNNGGGGDPFTPEQQPSPPAIPAALDEKST
AAAGKTMPMTAESSMLEPTLGGACLAMVMVATGMLFL

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	62	374	1.3e-96	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.83e-132	61	374	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	1.93e-104	107	372	2	263	Glycosyl hydrolase family 10.
226217	XynA	2.96e-78	55	376	17	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55005.1|GH10	8.88e-145	56	381	33	358
AAN60060.1|GH10	2.04e-143	59	381	36	358
AEO63155.1|GH10	1.03e-135	58	377	30	349
AUS45856.1|GH10	3.67e-135	59	381	25	347
BAA19220.1|CBM1|GH10|3.2.1.8	9.26e-135	61	376	21	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	3.65e-117	60	369	2	310	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	2.68e-109	60	372	24	335	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	2.07e-107	60	376	4	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUF_A	2.11e-91	61	376	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	5.24e-89	61	376	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J1Y4|XYN5_MAGGR	3.62e-144	59	381	36	358	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|G4MLU0|XYN5_MAGO7	3.62e-144	59	381	36	358	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|P79046|XYN1_HUMGT	1.64e-135	61	376	21	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	6.27e-113	61	380	21	338	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	6.54e-110	61	373	94	403	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999708	CS pos: 20-21. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in KLU85693.1.