CAZyme Information: KLU85055.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU85055.1
• CAZy Family: CE5
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A0C4DVS6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
942		105484.16	7.9649

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876968:1775523-1778441(+)

Full Sequence      

MLRIRRYRIFVVGAVILLFLLLRVSQNSQWEARRSAIYNSYAHRGTKDSKPTFSDQKQPS
QPVPDAKPEKAPTGPEPRPRPQRKTKLKPKVQVVEEKQPKQPAKHHDAAPVSNKVVIPEL
KPDPASEPPSRIIKGAPGKAPATTPKAALEDFKIPDREIGRDAGVKQRPLENGQNRLHAA
NPPSNRQSSVASSSTMSAPHWRKMPEHFPVAKKDVIPLPTGKPKKMPTIQHSFKAESVAD
REKREGRLAQVKKEMQRAWNGYRKYAWGHDELEPVTMSFRDPFCGWAATLVDAMDTLWIM
GMKKEFDDAYGALDNIDFTTTPYRHEIPVFETIIRYLGGLLAAYDVSGGHDGKHPKLLKK
AVELAEVLMSVFDTPNRMPVLYYNWMPEYASQPRRASAAAGVAELGTMSMEFTRLAQLTG
EDRYYDAIARITNAFEEWQNRGTALDGIFPQRVDATGCNRTAPAMTSLDLSTVDDAESKE
KKLGTRAVIQGLDGEGAASDLSGGNAAAARARLPDWDCTPQGLTDGGYGSGSYSMGGSQD
SAYEYFPKQYLLLGGLEPKYKTMHLKVVAAVKKYLLYRPMIKDEDRSLLFSASVYANSDA
AAAGTKLSYTYEVTHLTCFLGGMFALGGRIFGSAEDLDIGARLADGCVWAYESMPSGLMA
EDAAVVPCQTEASCPWNETVWHYHLDSNAEWRDSSVKDYLVRKKEWDEQKASLLKAEALR
VKKAEQKAAKRKQPAADSNDPLHRFGDGKDDGQDAGRPRRQLDSDDFTYSQGKAVLNESG
REKRGEGSEGSEGNEEPPYDPLWELPPEPSKPQTHEEYVRQRIEQEHLPPGYTAINSKNY
ILRPEAIESVWYMYRITGDKRWQEKGWRMFKAVIKATQTEHGHSAVDGVQYPDRAPAQLN
NMESFWLAETLKYFYLLYTTPDVISLDDWVLNTEAHPFKRPT

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	255	940	5.8e-170	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	254	940	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.36e-85	199	941	33	519	glycoside hydrolase family 47 protein; Provisional
223880	TonB	1.00e-06	50	148	46	142	Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope biogenesis].
236768	PRK10819	1.20e-05	61	147	79	162	transport protein TonB; Provisional
411408	PspC_subgroup_2	3.56e-05	47	144	390	499	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62321.1|GH47	0.0	1	941	1	1024
ERT02678.1|GH47|3.2.1.113	9.31e-279	2	942	4	1043
AEO67971.1|GH47	3.04e-276	154	942	130	882
AEO60003.1|GH47	1.48e-275	195	942	142	898
UQC81050.1|GH47	2.07e-273	5	941	5	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	7.79e-45	258	937	16	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.78e-45	258	937	21	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	9.14e-45	258	937	21	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	3.74e-44	258	937	99	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	3.77e-44	258	937	16	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2AJ15|MA1B1_MOUSE	7.42e-43	258	937	219	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	1.10e-42	251	937	184	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	1.32e-42	258	937	218	650	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|Q9UKM7|MA1B1_HUMAN	1.52e-42	258	937	260	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|O60476|MA1A2_HUMAN	1.15e-41	241	937	178	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999940	0.000087

TMHMM  Annotations     

Start	End
7	24