CAZyme Information: KLU84766.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU84766.1
• CAZy Family: CE4
• CAZyme Description: acidic mammalian chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		31391.24	8.1201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876968:859896-860788(+)

Full Sequence      

MSLVSISKSALAVLLAVSSVSACPPGSRHSQAINAVKPGSNTTGPAPATQPGSGSTAPAP
ATQPGSGTGPAPAGQPTFKTGMISAGYFAGFHAKRSKAFNVEQIPWSKYTDVKYSFAETA
SDGSLDYTGSHEEEIPKFVKAAHANGVKAQLAIGGWSGSIHWGNNVATAANRTAFVKTCL
DAVKKYDLDGLDFDWEYPGRKGLSCNTVSPEDSLNFIEFLKELRKAEPKKLWLSAAVSLF
PYTNKEGQRSANNELAPMAELLDYSMIMGYDVFGAWAATGGPNAPLSFACDSKRNNQG

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	84	287	2.9e-38	0.5641891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	3.01e-43	84	286	1	225	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	2.49e-39	85	286	3	200	Glyco_18 domain.
395573	Glyco_hydro_18	5.79e-39	85	288	3	193	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	6.14e-37	85	273	2	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
225862	ChiA	8.87e-35	83	286	39	267	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ63682.1|GH18	4.42e-104	81	298	42	259
UQC81261.1|GH18	3.10e-83	81	298	30	244
UPK94240.1|GH18	1.25e-78	82	298	27	239
CEI61705.1|GH18	1.67e-76	80	298	27	241
QPC70652.1|GH18	4.71e-76	82	298	29	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.50e-31	102	289	15	200	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	1.57e-22	147	288	123	265	Chain A, Glycosyl Hydrolase [Niallia circulans]
5Y29_A	1.09e-19	99	291	26	219	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	1.20e-19	99	291	26	219	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
3WL1_A	8.06e-19	99	286	26	215	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	1.82e-21	147	288	155	297	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P36362|CHIT_MANSE	2.91e-18	99	286	42	231	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q9W092|CHIT2_DROME	1.54e-17	98	291	59	254	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|Q9BZP6|CHIA_HUMAN	6.82e-17	147	286	90	228	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.21e-16	147	286	90	228	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001259	0.998719	CS pos: 22-23. Pr: 0.9281

TMHMM  Annotations     

There is no transmembrane helices in KLU84766.1.