CAZyme Information: KLU84298.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU84298.1
• CAZy Family: CE1
• CAZyme Description: S-formylglutathione hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	GL876967|CGC10	32125.22	6.1673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876967:4615388-4616522(-)

Full Sequence      

MAFTVKATIASFGGRLYKLLHKSPTTGTEMAVHLYVPPQSIRDGKKVPLLMYLSGLTCSP
DNCAEKGFFQHGAALAGIAIAYPDTSPRGLNLPGEDDDWDFGSAASFYIDSTQEPYAKNY
KMETYLTAELPDLLYGSEQGTKWLDRSKGLSITGHSMGGHGALTLYLKHPGMYRSVSAFA
PIANPTQCPWGQKAFAGYLGGDDKEEWKKHDATELVKGWKGGDLKMLIDVGTGDNFYKQK
QLLPENFEQAVKEAGLTGLSLRYQEDYDHSYYFMASFSDDHVNHAAKYLDV

Enzyme Prediction     

No EC number prediction in KLU84298.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	23	286	1.2e-44	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178061	PLN02442	4.29e-115	1	289	1	281	S-formylglutathione hydrolase
131868	fghA_ester_D	1.59e-104	7	289	4	275	S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification]
223700	FrmB	1.76e-66	11	289	15	312	S-formylglutathione hydrolase FrmB [Defense mechanisms].
395613	Esterase	1.19e-42	23	281	1	243	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
184875	PRK14875	0.004	154	181	203	230	acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAW03422.1|CE1	5.19e-14	23	233	56	255
APA94867.1|CE1	5.19e-14	23	233	56	255
AYF76557.1|CE1	7.98e-13	23	233	74	273
QUN21367.1|CE1	8.60e-13	27	233	2	197
QOW37594.1|CE1	8.60e-13	27	233	2	197

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FCX_A	1.38e-89	12	290	12	281	Chain A, S-formylglutathione hydrolase [Homo sapiens],3FCX_B Chain B, S-formylglutathione hydrolase [Homo sapiens]
1PV1_A	1.52e-74	13	289	11	296	Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae],1PV1_B Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae],1PV1_C Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae],1PV1_D Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae]
3S8Y_A	1.92e-73	11	290	12	279	Bromide soaked structure of an esterase from the oil-degrading bacterium Oleispira antarctica [Oleispira antarctica]
4FOL_A	6.90e-73	13	289	11	296	S-formylglutathione hydrolase Variant H160I [Saccharomyces cerevisiae],4FOL_B S-formylglutathione hydrolase Variant H160I [Saccharomyces cerevisiae],4FOL_C S-formylglutathione hydrolase Variant H160I [Saccharomyces cerevisiae],4FOL_D S-formylglutathione hydrolase Variant H160I [Saccharomyces cerevisiae]
6JZL_A	2.99e-72	11	289	11	277	S-formylglutathione hydrolase homolog from a psychrophilic bacterium of Shewanella frigidimarina [Shewanella frigidimarina],6JZL_B S-formylglutathione hydrolase homolog from a psychrophilic bacterium of Shewanella frigidimarina [Shewanella frigidimarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9R0P3|ESTD_MOUSE	8.15e-88	12	290	12	281	S-formylglutathione hydrolase OS=Mus musculus OX=10090 GN=Esd PE=1 SV=1
sp|P10768|ESTD_HUMAN	8.15e-88	12	290	12	281	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2
sp|Q9GJT2|ESTD_PIG	1.16e-87	1	290	1	281	S-formylglutathione hydrolase OS=Sus scrofa OX=9823 GN=ESD PE=2 SV=1
sp|B0BNE5|ESTD_RAT	3.29e-87	12	290	12	281	S-formylglutathione hydrolase OS=Rattus norvegicus OX=10116 GN=Esd PE=2 SV=1
sp|Q08E20|ESTD_BOVIN	3.99e-83	1	290	1	281	S-formylglutathione hydrolase OS=Bos taurus OX=9913 GN=ESD PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KLU84298.1.