CAZyme Information: KLU82833.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU82833.1
• CAZy Family: AA8|AA3
• CAZyme Description: glycosyl hydrolase family 88

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	GL876967|CGC10	43012.15	5.5463

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876967:41678-42805(+)

Full Sequence      

MPSEMHGLQAADIHAKIRLLIDGMVNIKDTTGEFLLRLDDGRVIDTKGWNDWEWTHGIGL
YGIWNYYQLTGDKGCLRIIEDWFRDRFAAGGTTKNINTMAVFLTLALVYEQTRNPTYLPW
LDAWAEWAYHDLGRTRFGGMQHTTYNMRNDEQLWDDTLMMTVVPLAKIGLVLDRPHYVAE
AKRQFLIHLRYLFDTRSGLFFHGWTFEDGGHNFARALWARGNSWLTIVLPEFIELLDLER
SDPPLYWHLRDALQAQCDALVPLQHPDTGLWRTLLDVPEDQGSYPETSATAGFAFGMLKA
RRKKYISGDDLEATAVRALKGVLDNIDEKGELCNTSFGTAMGHDLQHYKDIPITCMPYGQ
AMAIMALVEFLRVFI

Enzyme Prediction     

No EC number prediction in KLU82833.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	47	372	7.6e-102	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.50e-98	24	374	8	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	7.25e-90	26	374	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65407.1|GH105	2.53e-262	1	375	1	375
CAE76464.1|GH105	6.71e-212	1	375	1	375
QLI63582.1|GH105	2.42e-209	1	375	1	373
UPK91701.1|GH105	2.71e-208	1	375	1	372
UQC83867.1|GH105	1.66e-205	3	375	6	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	9.28e-201	10	375	5	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	2.24e-146	6	372	19	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.44e-142	11	372	25	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	5.61e-40	52	372	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.33e-10	169	330	10	177	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.33e-10	169	330	10	177	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	3.42e-08	145	297	189	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000013

TMHMM  Annotations     

There is no transmembrane helices in KLU82833.1.