CAZyme Information: KLU82454.1

Basic Information

• Species: Magnaporthiopsis poae
• Lineage: Ascomycota; Sordariomycetes; ; Magnaporthaceae; Magnaporthiopsis; Magnaporthiopsis poae
• CAZyme ID: KLU82454.1
• CAZy Family: AA7
• CAZyme Description: GH131_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0C4DNX7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		33155.41	9.8724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MpoaeATCC64411	12363	644358	200	12163

• Gene Location: location=GL876966:4927096-4928334(+)

Full Sequence      

MRSSFVPTLSLALSVSAQSCKLQFDGRIPNTFQLAQFDATNNIFNPKNVFGKDLSFSKLL
QLPKTAGSLFDSNGTQPLEVTISDKSIFVPNANTVQNGFRRAELLAASNSGTDDSTKGVK
TLHFSIAKDAQRPLNLSHEYQLVFLEDNSFSTNQIVLKTGTILGQNTSEPDTLQLFGNVK
ENPPKVLFSTPFAATGFHNFAVTMDFNKNTTQVLFSKGTEPLKAVTQPVANDVSGGGQFH
FGMLKKGLEGGNDIVRNGIQPSGINEGVIYGGIFMEDSSTGCVSLSPTAKAQAKGKANTN
KRTKRFSA

Enzyme Prediction     

No EC number prediction in KLU82454.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	24	282	2.9e-76	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.08e-89	22	281	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65172.1|GH131	3.54e-134	15	289	20	296
UQC91294.1|GH131	5.73e-122	12	287	90	365
UQC90347.1|GH131	3.43e-114	9	287	10	285
VBB76803.1|GH131	2.41e-107	14	287	16	276
AEO64872.1|GH131	5.05e-103	4	286	8	277

PDB Hits     

KLU82454.1 has no PDB hit.

Swiss-Prot Hits     

KLU82454.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.557722	0.442273

TMHMM  Annotations     

There is no transmembrane helices in KLU82454.1.